Welcome to Striped

A free, fully responsive HTML5 site template by HTML5 UP

July 14, 2014

Pythagoras Der Quintenwolf Und Das Komma - An Atlas Of Rectal Endosonography - Digital Products - Die Reichseisenbahnen - Steuerungstechnik Maschinenbauer - Becoming Oneself - Die Schwimmbagger - Der Wirtschaftliche Aufbau Der Elektrischen Maschine - Kompendium Der Frauenkrankheiten - Die Einsamkeit Des Schreibers - Die Unmittelbare Kranken-untersuchung - Die Vereinfachte Berechnung Biegsamer Platten - Technischer Lehrgang Ventile - Die Gescheiterte Zukunft Der Ersten Republik - High-performance Scientific Computing - Orthopdisch-chirurgische Operationslehre - Das Entscheidungssystem Der Europischen Union - Adrenergic System And Ventricular Arrhythmias In Myocardial Infarction - Die Neueren Arzneimittel Und Die Pharmakologischen Grundlagen Ihrer Anwendung In Der Rztlichen Praxis - Franzsische Apotheken-praxis - Praxishandbuch Presse- Und –ffentlichkeitsarbeit - Das Neue Arbeitsrecht - Mathematische Tafeln Markscheider Und Bergingenieure Sowie Zum Gebrauche Bergschulen - Spielen Frauen Ein Anderes Spiel - Metastatic Bone Disease - Principles Of Petroleum Reservoir Engineering - Einhrung In Die Reaktionstheorie - Buchhrung Und Jahresabschluy - Die Dynamik Organisierter Beschftigungsfrderung - Psychische Strungen Im Kindes- Und Jugendalter - Unix Systemverwalter - Die œberhrung Kommunaler Betriebe In Die Form Der Gemischt Wirtschaftlichen Unternehmung - Heute Akquirieren - Sofort Profitieren - Forests Elements Of Silvology - Elemente Nachrichtentechnischer Systeme - Organisation Und Akzeptanz - Nerve-muscle Interaction - Stadtgesellschaft Und Kindheit Im Prozey Der Zivilisation - Imaging Of The Brain In Psychiatry And Related Fields - Die Sozialen Aufgaben Der Arbeitgeber - Der Bankbetrieb - Allgemeine Wirtschaftslehre Broberufe - Formulieren Und Korrespondieren Im Beruf - Recent Developments In Micromechanics - Office-based Infertility Practice - Beschftigungschancen Und Betriebszugehrigkeit - Stability Theory - Algebraische Grundlagen Der Informatik - Multimedia Und Multi-moderne Schlsselbilder - Marketing Intelligence - Das Verbrechen Iii - Startup - Der Dampfbetrieb - The Perfect Test - Soziologie Im Nationalsozialismus Zwischen Wissenschaft Und Politik - Wirtschaftslehre Bankkaufleute - Die Hysterie - Mehr Gewinn Durch Systematische Vermgensplanung - Genetics Of Fungi - Praxis Ohne Theorie - Demokratietheorie Und Demokratieentwicklung - Theorie Der Stochastischen Automaten - Diagnostik Und Therapeutische Indikationsstellung Bei Den Chirurgischen Erkrankungen Der Harnorgane - Die Entwicklung Der Zahnrad-technik - Advances In Nitrate Therapy - Pathophysiologie Und Rationale Pharmakotherapie Der Myokardischmie - Die Mediatisierung Kommunikativen Handelns - Integrierte Produktentwicklung - The Purchasing Chessboard - Theoretical Physics Text And Exercise Books - Wohlfahrtsstaat Transformation Und Perspektiven - Rechtsstaat Und Demokratie - Die Festigkeit Von Druckstben Aus Stahl - Die Reform Des Hheren Schulwesens Auf Grund Der Ostendorfschen These Der Fremdsprachliche Unterricht Ist Mit Dem Franzsischen Zu Beginnen - Handbook Of Technical Diagnostics - Fallsammlung Steuerlehre Rechnungswesen - Fit Nachhaltigkeit - Rock Mechanics - Geldanlage In Steueroasen - Anleitung In Der Galvanischen Und Faradischen Behandlung - Matlab For Psychologists - Grundlagen Der Strahlungsphysik Und Des Strahlenschutzes - Kulturmanagement - A Therapist Manual For Cognitive Behavior Therapy In Groups - Gesellschaft Innovativ - Value Reporting - Das Vegetative Nervensystem - Differenz Und Integration Die Zukunft Moderner Gesellschaften - Gerontopsychiatrie Und Alterspsychotherapie In Deutschland - Menschen Maschinen Mrkte - Nahost Jahrbuch 2002 - Panic And Phobias 2 - Flexibilitt In Langfristigen Vertrgen - Grundzge Einer Soziologie Des Musikgeschmacks - Baufachrechnen - Politik Und Verwaltung Nach Der Jahrtausendwende Pldoyer Eine Rationale Politik - Life Politics - Teubner-taschenbuch Der Stochastik - Experimentelle Beitrge Zu Einer Theorie Der Entwicklung - Die Kessel- Und Maschinenbaumaterialien Nach Erfahrungen Aus Der Abnahmepraxis Kurz Dargestellt Werksttten- Und Betriebsingenieure Und Konstrukteure - Die Grundlagen Der Nomographie - Unabhngige –ffentlichkeit Und Soziale Bewegungen - Die Spt-renaissance - Processed Meats - Der Schdelschuy - Handbuch Der Eierkunde - Beginning Teaching - Evolution Der Sprache Und Vernunft - Wie Das Internet Die Politik Verndert - Der Mythos Vom Niedergang Der Intelligenz - Innovative Unternehmenskommunikation - Rntgendiagnostik Des Herzens Und Der Grossen Gefsse - Sorgende Arrangements - Der Altersprsident - Creo Parametric 20 Einsteiger - Kurz Und Bndig - Light Scattering Spectra Of Solids - Eliten Macht Und Konflikt In Der Bundesrepublik - Grundlegende Algorithmen - Depressive Illness - Chemical Sensors - Journalistenausbildung Eine Vernderte Medienwelt - Regelungstechnik Maschinenbauer - Magmatism In Extensional Structural Settings - Kernpunkte Der Preisbildung Im Verkehrswesen - Problems In Stellar Atmospheres And Envelopes - Handbuch Gefahrstoffbeauftragte - Quark Matter - Umwelt-und Naturschutz Am Ende Des 20 Jahrhunderts - Freiheitsverlust Und Freiheitsentziehung - Spannungsfeld Personalentwicklung - Einhrung In Die Deutsche Literatur Des 12 Bis 16 Jahrhunderts - œbungsbuch Strmungsmechanik - Enzymologie - Thonner Analytical Key To The Families Of Flowering Plants - Berufsbiografie Und Familiengrndung - Nachhaltigkeitswissenschaften - Das Chaos Managen - Europische Geschichte Und Politik 18711881 - Handbuch Der Forstpolitik Mit Besonderer Bercksichtigung Der Gesetzgebung Und Statistik - Genetic Constraints On Adaptive Evolution - Chemische Elementarprozesse - Karrierewege Als Thema Der Internen Kommunikation - Packen Sie An - Html5 Games Most Wanted - Modeling And Managing Shallow Lake Eutrophication - Shock Waves @ Marseille Iv - Die Betriebswissenschaft Des Eisenbahngtertarifs - Grundriss Einer Meteorobiologie Des Menschen - Hchstspannungs-tagung Essen - Totale Institution Und Rechtsschutz - Elemente Der Mechanik Iv - Arbeitszeit - Zeitarbeit - Walsh-funktionen Ingenieure Und Naturwissenschaftler - Die Verletzungen Der Sehbahnen Des Gehirns Mit Besonderer Bercksichtigung Der Kriegsverletzungen - Abhandlungen Aus Dem Aerodynamischen Institut An Der Technischen Hochschule Aachen - Expertiseforschung - Differentialdiagnose In Der Inneren Medizin - Die Eigenschaften Des Betons - Language Grounding In Robots - Governance Von Schul- Und Elementarbildung - Das Reichsgesundheitsamt 18761926 - Chromosomal Alterations - Structured Document Image Analysis - Principles Of Abrasive Water Jet Machining - Lehrbuch Der Thermochemie Und Thermodynamik - Sensory Evaluation Of Food - Drug Discovery And Evaluation Safety And Pharmacokinetic Assays - Wirtschaftliche Rationalitt - Technische Mechanik Statik - Exkursionsbuch Zum Bestimmen Der Vgel In Freier Natur Nach Ihrem Lebensraum Geordnet Laien Und Fachleute - Leistungsfhigkeit Und Keimdrsenhormone - Die Kollapstherapie Der Lungentuberkulose - Dampfkesselfeuerungen Braunkohle - Drilling Mud And Cement Slurry Rheology Manual - Gefeuert Und Jetzt - Shock Waves In Materials Science - Werkstoffe Gleitlager - Kompetent In Die –ffentlichkeit - Internationaler Austausch In Der Sozialen Arbeit - Blutkonservierung Und Transfusion Von Konserviertem Blut - Physikalisch-chemisches Rechnen - Die Radium- Und Mesothoriumtherapie Der Hautkrankheiten - Verstndigungsprobleme Und Gestrte Kommunikation - Algorithmen Ingenieure - A History Of Experimental Virology - Geschlecht Und Geschlechterverhltnisse In Der Erziehungswissenschaft - Bildung Neu Denken! Das Zukunftsprojekt - Objektives Verstehen - Stoffwechsel Der Landwirtschaftlichen Nutztiere - Vertragsrecht Im Einkauf - Normativitt - Glasfaserverstrkte Kunststoffe - Cross Border Experts 2011 - Mehrfachregelungen - Operationslehre Der Endoskopischen Chirurgie - Individualisierung - Technologie Wachstum Und Beschftigung - Technik Aus Soziologischer Perspektive - Current Topics In Contact Dermatitis - Starthilfe Stochastik - Freundschaften Cliquen Und Jugendkulturen - Soziales Vertrauen - Elektronen Im Kristall - Wege Zum Projektorientierten Unternehmen - Methoden Zur Bestimmung Pflanzlicher Wuchsstoffe - Indikation Zur Operation - Toward The Factory Of The Future - 100 Grafik-rezepte Turbo Pascal Unter Windows - 5-phasen-methode Der Markenbewertung - Telearbeit - Die Geburt Der Vernunft - Grundriss Der Entwicklungsgeschichte Des Menschen - Assessment Center - Die Neue Rechte Eine Gefahr Die Demokratie - Leben In Der Stadt - Biologie Der Ssswassertiere - Biogeography And Taxonomy Of Honeybees - Das Neue Europarecht - Das Gedchtnis Des Rundfunks - Sozialkundestunden - Die Unternehmer-elite - Allgemeine Rntgenkunde - Medienkriege - Population Biology - Prfungsvorbereitung Organisation Und Datenverarbeitung - Denklchrift Ber Das Ffentliche Gesundheitswesen Helgolands Die Jahre 18861889 - Mit Sicherheit Gesund Bauen - Soziologische Aufklrung 2 - Der Pdagoge Salzmann - Blaue Hemden Rote Fahnen - Die Ethnisierung Von Alltagskonflikten - Studium Nach Bologna Praxisbezge Strken! - Aus Dem Bernerland - Fuzzy-theorie Oder Die Faszination Des Vagen - Blade Runner Matrix Und Avatare - Elektromagnetische Strahlungsfelder - Beitrge Zur Psychodynamik Endogener Psychosen - The Right Heart - Die Lehre Vom Wirtschaftsbetrieb Allgemeine Betriebswirtschaftslehre - Steuerstandort Groybritannien - Lexikon Der Psychiatrie - Politik In Sachsen - Die Bedeutung Europas In Der Auyenpolitik Der Usa - Qualitativ-empirische Sozialforschung - Lehrbuch Der Demagogik - Corporate Identity - Auslandsmarketing - Handbuch Jugend - Musik - Sozialisation - Festigkeitseigenschaften Und Gegebilder Der Konstruktionsmaterialien - Ferdinand Pi«ch - Vertragsfreiheit Und Typengesetzlichkeit Im Recht Der Personengesellschaften - Preuyische Personalabbau Bei Staat Und Gemeinden - Die Reizbewegungen Der Pflanzen - Globalisierung Der Medien - Affective And Schizoaffective Disorders - Systemwechsel Und Demokratisierung - Elemente Des Werkzeugmaschinenbaues - Gentrification - Anatomie Und Technik Der Leitungsansthesie Im Bereiche Der Mundhhle - Waren Und Dienste - Bauteilberechnung Und Optimierung Mit Der Fem - Geschftsprozesse Realisieren - Unternehmen Auf Neuem Kurs - Classical Dynamics And Its Quantum Analogues - Erziehung Im Sozialen Umfeld - Soziale Distanz - Eisenbahngterverkehr - Der Beckenboden Der Frau - Muttersprache · Identitt · Nation - Enabling Systematic Business Change - Bericht œber Die Achtundvierzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1930 - Der Ursprung Des Zahlbegriffs - Gewalt Und Konflikt In Einer Globalisierten Welt - Die Neurologisch-neurochirurgische Frhrehabilitation - Leybold Vakuum-taschenbuch - Die Septischen Erkrankungen In Der Inneren Medizin - Moderne Identitt Und Gesellschaft - Matlab Und Simulink In Der Ingenieurpraxis - Grundzge Der Technischen Wirtschafts- Verwaltungs- Und Verkehrslehre - Vernderungsmanagement - Das Prinzip Nation In Modernen Gesellschaften - Steps To Compliance With International Labour Standards - Carbon Capture - Bausteine Ein Zukunftsfhiges Deutschland - Die Gasturbine - Lebensfragen - Migration Und Traditionsbildung - Theoretische Grundlagen Der Elektrotechnik 1 - Thermodynamische Eigenschaften Umweltvertrglicher Kltemittel Thermodynamic Properties Of Environmentally Acceptable Refrigerants - Bedarfsorientierte Kinderbetreuung - Die Hebezeuge Theorie Und Kritik Ausgehrter Konstruktionen Mit Besonderer Bercksichtigung Der Elektrischen Anlagen Ein Handbuch Ingenieure Techniker Und Studirende - Charakter Und Umwelt - Die Geschlechtskrankheiten Und Ihre Bekmpfung - Unser Alltag Ist Voll Von Gesellschaft - Anleitung Ein Erfolgreiches Stadtentwicklungsprogramm - Montage Als Kunstform - Hilfsbuch Mineralltechniker - Das Holz Der Deutschen Nadelwaldbume - Einhrung In Die Meytechnik - Erziehungswissenschaftliche Zugnge Zur Waldorfpdagogik - Holzbau - Die Landschaften Der Britischen Inseln - Expressive Ungleichheit - Privatsache Kind Privatsache Beruf - Datenreport Erziehungswissenschaft - Magnetic Resonance Imaging And Spectroscopy In Sports Medicine - Einhrung In Die Statistik - Konvergenz Des Rechnungswesens - Die Neue Arbeitsgerichtsbarkeit - Reflexiver Sprachgebrauch - Verbrennungsmotoren - Aus Der Praxis Des Taylor-systems - Das Journalistische Interview - Chirurgenverzeichnis - Wissenskapitalisten Oder Sldner - A Manual Of Morphometry In Diagnostic Pathology - Die Verunsicherte Generation - Die Inventur - Co2-laser In Der Stapeschirurgie - Fremdenfeindlichkeit Und Rechtsextremismus - Die Psychogenen Reaktionen Einschlieylich Der Sogenannten Entschdigungsneurosen - Mitteilungen Der Deutschen Materialprfungsanstalten - Java-grundkurs Wirtschaftsinformatiker - Gabler Euro-wrterbuch Bank Und Brse - Dampfturbinenkraftwerke Kleiner Und Mittlerer Leistung - Kernprobleme In Der Geschichte Der Psychologie - Der Mineralbestand Des Krpers - Mikrokonomie Kompakt - Exploration Of Halley Comet - Norm Herrschaft Und Vertrauen - Preismodelle Deutscher Banken Im Privatkundengeschft - Biographie Und Technikgeschichte - Erluterungen Zu Den Normalien Isolierte Leitungen In Starkstromanlagen Den Normalien Isolierte Leitungen In Fernmeldeanlagen Sowie Den Kupfernormalien - Bevlkerungslehre Und Bevlkerungspolitik Im „dritten Reich - Das Weltgebude Im Lichte Der Neueren Forschung - Goethes Und Schopenhauers Stellung In Der Geschichte Der Lehre Von Den Gesichtsempfindungen - Timssiii Dritte Internationale Mathematik- Und Naturwissenschaftsstudie Mathematische Und Naturwissenschaftliche Bildung Am Ende Der Schullaufbahn - Vertriebsrecherche Leicht Gemacht - Jugend Freizeit Geschlecht - Personalauswahl Im Vertrieb - Allgemeine Pharmakologie - Stadt Und Kultur - Prfungsvorbereitung Sekretrinnen - Trends In Control - Strategisches Kndigungsverhalten - Die Chemischen Processe Und Stchiometrischen Berechnungen Bei Den Prfungen Und Wertbestimmungen Der Im Arzneibuche Das Deutsche Reich Vierte Ausgabe Aufgenommenen Arzneimittel - Kommunikation In Der Organisation - Wege Zu Neuen Arzneimitteln - Wasserkonflikte Sind Machtkonflikte - Versuchungen - Korea - Bilanz Der Bundestagswahl 2002 - Kolben- Und Turbo-kompressoren - Abwehrfermente - Handbuch Bildungsforschung - Zielgruppe Kind Kindliche Lebenswelt Und Werbeinszenierungen - Die Dynamik Sozialer Und Sprachlicher Netzwerke - Machtfaktor Auch Ohne Machtbasis - Steuerliche Wahlrechte - Familienerziehung Im Historischen Wandel - Mechanik Der Kontinua - Zukunft Einer Frauengerechten Gesundheitsversorgung In Nrw - Geldanlage Mit Optionsscheinen - Irrtum Und Wahrheit Ber Wasserkraft Und Kohle - Steine Und Steinbrche Im Alten „gypten - Hochfrequenzmesstechnik - Klinische Rheumatologie - Controlling Im Handel - Der Anspruch Auf Ein Patent Und Das Recht An Der Erfindung - Aufgaben Aus Der Maschinenkunde Und Elektrotechnik - Fractals And Disordered Systems - Der Verborgene Hunger - Die Kohlenoxydvergiftung - Reoperative Hand Surgery - Vieweg Lexikon Technik - Wechselwirkungen Zwischen Organisation Und Social Software In Der Wissensarbeit - Innovative Personalentwicklung - Effizient Lesen - Der Reiz Des Trivialen - Compound Semiconductor Device Modelling - Dr Gablers Wirtschafts-lexikon - Lehrbuch Der Textilchemie - Das Waschen Mit Maschinen In Gewerblichen Wschereibetrieben In Hotels Krankenhusern Und Anderen Ffentlichen Und Privaten Anstalten - Weltorganisationen - Practical Api Design - Praxis_ci - Mehrfachausbildungen In Deutschland - Biologically Active Molecules - Datenbank-engineering - Zement - The Hippocampus - A Handbook For Clinical Teachers - Bildung Arbeit Erwachsenwerden - Die Harnrhren-gonorrhoe Des Mannes Und Ihre Komplikationen - Die Technik Der Negativ- Und Positivverfahren - Sozialitt In Slow Motion - Axial- Und Radialkompressoren - Entwicklung Eingebetteter Systeme - Analyse Der Fette Und Wachse - Computer Graphics - Frauen Und Mnner In Der Mobilen Gesellschaft - Die Zukunft Von Nationalstaaten In Der Europischen Integration - Laienkompetenz Im Psychosozialen Bereich - Der Schwierige Weg Zur Demokratie - Flood Response And Crisis Management In Western Europe - Praxiswissen Chemie Techniker Und Ingenieure - Die Gleichstrom-dynamomaschine - Trends In Research And Treatment Of Joint Diseases - Die Ferromagnetischen Legierungen Und Ihre Gewerbliche Verwendung - Objektorientierte Programmierung Mit Turbo Pascal - Rntgenanatomie Des Gefysystems - Transportvorgnge In Der Verfahrenstechnik - Transnationale Vergesellschaftungen - Tof Range-imaging Cameras - Grundlagenwissen Medien Journalisten - Klinische Pathophysiologie Der Atmung - Oxygen Basis Of The Regulation Of Vital Functions In The Fetus - Alzheimer Disease - Produktionssthetik Und Produktionsdidaktik - Neurophysiologische Untersuchungsmethoden In Der Intensivmedizin - Prventive Sucht- Und Drogenpolitik - Die Vorkalkulation Im Kessel- Und Apparatebau - Principles Of Infrared Technology - Vergaberecht In Der Unternehmenspraxis - Schwierigkeiten Mit Dem Gedenken - Integrative Biological Psychiatry - Anatomie Der Hrrinde - Religion Bei Meinungsmachern - Die Ausrstung Der Textilen Waren - Handbuch Soziale Probleme - Die Unipolare Gleichstrommaschine - Elementare Differentialgeometrie Mit Maple - Wahrscheinlichkeitstheorie Und Statistik - Progress In Mathematical Programming - Handbuch Des Normalen Und Gestrten Schlafs - Ehrenamt Und Integration - Feldanalyse Als Forschungsprogramm 2 - Urbanismus Und Verkehr - Wolfsburg Stadt Am Wendepunkt - Diagnostische Bewertung Von Laborbefunden - Entwicklung Von Arbeitsorganisationen - Einhrung In Die Physikalische Chemie Der Eisenhttenprozesse - Die Dritte Generation Der „roten Armee Fraktion - Lebenserinnerungen Eines Ingenieurs - Global Events And Event Stratigraphy In The Phanerozoic - Baumwollspinnerei - Customer Integration - Ernhrungs- Und Stoffwechselkrankheiten Und Ihre Behandlung - Keine Probleme Mit Inversen Problemen - Hygienische Volksbildung - Waste Management - Chemical Water And Wastewater Treatment Iii - Stochastische Optimierung - Hydrostatische Mess-instrumente - Gut Beraten Durch Die Promotion - Lehrbuch Der Arithmetik Und Algebra Hhere Lehranstalten Bearbeitet - Production Wine Analysis - Abschottungs- Und Anwerbungsstrategien - Supply Chain Scheduling - Industrial Production Models - Second Generation Expert Systems - Current Topics In Cybernetics And Systems - Thin-layer Chromatography - Traumberuf Medien - Der Psychologische Test - Mediation - Elektrokeramik - Die Physikalische Komponente Der Pflanzlichen Transpiration - Advances In Turbulence - Clustering-based Support For Software Architecture Restructuring - Die Wischendampfverwertung In Entwicklung Theorie Und Wirtschaftlichkeit - Arbeitsbetonter Deutschunterricht Als Mittelpunkt Der Geistesbildung Im 4 Schuljahr - Entfesselte Wissenschaft - Systematisches Arbeiten Mit Basic - Die Auyenpolitik Kanadas - Supramolekulare Chemie - œbungen Zur Technischen Strmungslehre - Multimedia-kommunikation - Pretreatment In Chemical Water And Wastewater Treatment - Geschichte Und Struktur Des Deutschen Parteiensystems - Zur Organisation Des Grndungserfolgs - Geologische Voraussetzungen Wasserkraftanlagen - Advances In Nuclear Physics - Mikrofluidik - Mathcad In Der Tragwerksplanung - Jedem Kind Sein Instrument - Der Augenhintergrund Bei Allgemeinerkrankungen - Nuclear Endocrinology - Rechtsbewusstsein In Der Demokratie - Raising Public Awareness Of Mathematics - „rztliche Merkbltter Ber Berufliche Erkrankungen - Brain Behaviour And Iron In The Infant Diet - Einhrungskurs Hhere Mathematik - Marketing Entscheider - Integral Transforms In Geophysics - Air-surface Exchange Of Gases And Particles 2000 - Die Hirnttigkeit Des Suglings - Medienalltag - Patent Filing Strategies And Patent Management - Die Harnsteine - High Precision Navigation - Klinik Der Lungentuberkulose - Flow Cytometry In Microbiology - Familie In Der Gesellschaft - Die Forsteinrichtung - Jahrbuch Verkaufstraining 20002001 - Die Medikamentse Und Allgemeine Behandlung Der Ohrenkrankheiten - Industrielle Betriebshrung - Pfadintegrale In Der Quantenphysik - Formelsammlung Wirtschaftsmathematik - Sprechwissenschaft And Psycholinguistik - Das Managementmodell Der Jesuiten - Implementing International Services - Die Akkumulatoren Elektricitt - Organisation Im Bankbetrieb - Psychologie „sthetischer Wahrnehmungen - The Pneumonias - Environmental And Space Electromagnetics - Einhrung In Die Abfallwirtschaft - Nationale Identitt Im Wandel - The Decade Of Medicine Or The Physician Of The Rich And The Poor - Die Apparatfrberei Der Baumwolle Und Wolle Unter Bercksichtigung Der Wasserreinigung Und Der Apparatbleiche Der Baumwolle - Die Wassersperrarbeiten Bei Bohrungen Auf Erdl - Management Problems In Health Care - Konservative Revolution Und Neue Rechte - Die Organisation Der Riesenstadt - Muttersprache Vaterland - Einwanderungsland Hessen - Die Sanften Managementrebellen - Auswrtiges Amt - Ophthalmologische Ultraschalldiagnostik - Das Wasser Seine Verwendung Reinigung Und Beurtheilung Mit Besonderer Bercksichtigung Der Gewerblichen Abwsser Und Der Fussverunreinigung - Gesundheitsbchlein - Pfadfinden - Die Operative Beseitigung Der Bauchbrche Die Eingriffe An Den Weiblichen Geschlechtsorganen - Die Empirisch-wissenschaftliche Sicht - Immunopharmacology Reviews - Ihr Kopf Ihr Kapital - Dringliche Thoraxchirurgie - Gruppenprozesse Verstehen - Die Genaue Berechnung Von Trgerrosten - Was Manager Von Der Blattlaus Lernen Knnen - Landslides And Their Stabilization - Access To B-isdn Via Pons - A Handbook Of Treatment - Der Kondensator In Der Starkstromtechnik - Testen Von Informationssystemen - Das Pirquetsche System Der Ernhrung - Die Regelung Der Kraftmaschinen - Die Hebezeuge Theorie Und Kritik Ausgehrter Konstruktionen Mit Besonderer Bercksichtigung Der Elektrischen Anlagen Ein Handbuch Ingenieure Techniker Und Studierende - Atlas Of Electroencephalography In Sleep Medicine - Mikropolitik - Beitrge Zur Geschichte Der Naturwissenschaften Und Der Technik - Energie - Renditechancen 2011 - Neue Soziale Risiken Und Soziale Arbeit In Der Transformationsgesellschaft - Familienbildung In Deutschland - Die Technik Des Khlschrankes - Ellenberger-schtz Jahresbericht Ber Die Leistungen Auf Dem Gebiete Der Veterinr-medizin - Deutschland Nach Der Wende - Forstliche Bodenkunde Und Standortslehre - Das Schmerzproblem Und Seine Forensische Bedeutung - Solidaritt Lebensformen Und Regionale Entwicklung - Turbo Pascal-wegweiser Aufbaukurs - Transatlantik - Alkaline Rocks And Carbonatites Of The World - Chemical Structures 2 - Basic-wegweiser Ibm Pc Pc Xt Portable Pc Und Pcjr - Menschenrechtsbildung - Bone Marrow And Bone Tissue - Belastung Und Beanspruchung Im Lehrerberuf - Untersuchung Und Bestimmung Der Lipoide Im Blut - First Leaves A Tutorial Introduction To Maple V - International Yearbook Of Nephrology 1993 - Der Tod In Dichtung Philosophie Und Kunst - Eigentumswohnungen Als Kapitalanlage - Technischer Lehrgang Automatikgetriebe - Die Extreme Rechte In Der Bundesrepublik - Introduction To Formal Grammars - Working Through Ethics In Education And Leadership - Fifth Generation Computer Systems 1988 - Physikalische Metallkunde - Finanzmrkte Nach Dem Flchenbrand - Reflectance Spectroscopy - The Human Yolk Sac And Yolk Sac Tumors - Coaching Als Maynahme Der Personalentwicklung - Technologiegesttzte Dienstleistungsinnovation In Der Gesundheitswirtschaft - Von Adenauer Zu Schrder Der Kampf Um Stimmen - Mechanik Deformierbarer Krper - Zwischen Wirtschaftstheorie Und Wirtschaftspolitik - Fernsehfinanzierung - Lehrbuch Der Toxikologie Studium Und Praxis - Turbo Pascal Version 60 - Das Bdm-werk „glaube Und Schnheit - Textoptimierung Printmedien - Elastische Platten - Plasmids - Mechanisms Of Chromospheric And Coronal Heating - Bezugsgruppenwechsel Und Bildungsaufstieg - Corporate Divestiture Management - Sanierung Und Facility Management - Der Richter Wesen Und Verfassungsrechtliche Stellung - Lineare Algebra Und Analytische Geometrie Ii - Fertility Control Update And Trends - Reoperations In Cardiac Surgery - Information Processing In The Nervous System - Lehrbuch Der Gesteins- Und Bodenkunde - The International Monetary System - Complications In Ptca - Friedrich Engels Eine Biographie - Der Professionelle Lehrer - Zahlungsverhalten Am Stationren Point Of Sale - Spieltheorie - Manual Of Internal Fixation In The Horse - Anlagechancen 2011 - Wirtschafts- Und Bevlkerungsstatistik - Menschen Auf Der Flucht - Energieeffiziente Elektrische Antriebe - Algebraische Algorithmen - Neue Amerikanische Verkaufs- Und Lagerverfahren - Angewandte Tierzucht Auf Rassenbiologischer Grundlage - Biochemisches Handlexikon - Das Elend Der Suchtprvention - Dichtung Und Menschenkenntnis - Die Us-amerikanische Somaliaintervention 1992-1994 - Politische Philosophie Im Denken Heideggers - Kultur In Der Stadt - Umweltorientierte Lebenszyklusrechnung - Distributionen Und Ihre Anwendung In Der Physik - Poetik Des Abgrunds Und Kunst Des Widerstands - Journalistisches Handeln - Interventional Radiology In Bone And Joint - Handbuch Elternbildung - Nachhaltige Wasserbewirtschaftung - Kriminaltaktik Mit Besonderer Bercksichtigung Der Kriminalpsychologie - Surgical Ophthalmology - Inszenierungen Zur Gentechnik - Bewehren Nach Din En 1992-1-1 Ec2 - Kolloidchemie - Islamverherrlichung - Jahresbericht Ber Die Beobachtungs-ergebnisse Der Von Den Forstlichen Versuchsanstalten - Versicherungsmathematik - Charisma - Body Experience - Geschwisterkonstellation Und Psychische Fehlentwicklung - Die Werksgemeinschaft In Historischer Und Soziologischer Beleuchtung - Lernen Und Erfahrung - „sthetische Kommunikation Der Moderne - „als Der Geist Der Gemeinschaft Eine Sprache Fand - Staatliche Institutionenbildung In Ostdeutschland - Insect Conservation Past Present And Prospects - Moderne Lern-zeiten - Globale Konflikte Oder Global Governance - Schaltungen Der Datenverarbeitung - Inszenierungsgesellschaft - Lehrbuch Der Massage - Deutsche Europapolitik Von Konrad Adenauer Bis Gerhard Schrder - Innovationskompetenz In Unternehmen - Menschenrechte Und Brgergesellschaft In Deutschland - Diskurs - Macht - Subjekt - The Social Foundations Of Meaning - Schlechthin Bse - Die Werkzeuge Und Arbeitsverfahren Der Pressen - Marketing Lohas - Geburtshilflich-gynkologische Propdeutik - Lehrbuch Der Pharmakognosie - Lehrbuch Der Chemischen Technologie Und Metallurgie - Einhrung In Die Sozialwissenschaftliche Datenanalyse - Liquid Hydrogen - Kind Und Wohnen - Eisenbahnanlagen Und Fahrdynamik - Einwanderungsrecht National Und International - Biologie Und Philosophie - Handelsbilanzen - Elementare Numerische Mathematik - Politikkompetenz - Kfz-rechnen - Qualitt Im Kinderfernsehen - Adhesives Technology Compendium 2011 - Theorie Ideal Plastischer Krper - Earth Rotation From Eons To Days - Gewerkschaften Ohne Vollbeschftigung - Soziologische Beratung - Sozialer Wandel In Den Neuen Bundeslndern - Staatenkooperation In Der Eu Und Darber Hinaus - Deutsche „rzte - Reden - Friedrich Engels Schriften Der Frhzeit - Proactive Intelligence - Masterkurs Wirtschaftsinformatik - Atlas Of Bone Scintigraphy In The Developing Paediatric Skeleton - Qualitative Bildungs- Und Arbeitsmarktforschung - Kleines Fachbuch Der Kakaoerzeugnisse - Multiresonator-based Chipless Rfid - Besondere Aspekte Der Extrakorporalen Zirkulation - Soziale Struktur Und Wissenschaftliche Praxis Im Wandel - Brokommunikation Von Der Planung Bis Zur Erfolgskontrolle - Cerebral Ischemia - Semantik Der Deixis - Einfachste Grundbegriffe Der Topologie - Encyclopedia Of Textile Finishing - Finanzmathematik Mit Matlab - Gear Motor Handbook - Communicate Or Die - Comprehensive Lipid Testing And Management - Die Eingriffe Am Gehirnschdel Gehirn Gesicht Gesichtsschdel An Der Wirbelsule Und Am Rckenmark - Finite Dimensional Algebras - Wohlfahrtsstaatliche Politik - Altersvorsorge Am Scheideweg - Familie Und Staatliches Handeln - Eisenbahnoberbau - Dimensionen Einer Neuen Kultur Des Politischen - Alte Menschen In Ihrer Umwelt - Handbuch Wissenschaftssoziologie - Structural Neurochemistry - Lehrbuch Der Funktionellen Diagnostik Und Therapie Der Erkrankungen Des Herzens Und Der Gefsse - Frauenerwerbsttigkeit In Geschlechterregimen - Informatik Pc-orientierte Informationstechnische Grundbildung - Lehrbuch Der Differentialdiagnose Innerer Krankheiten - Familienleitbilder Und Familienrealitten - Infected Total Joint Arthroplasty - Wem Dient Der Auswrtige Dienst - The Vendian System - Free Radical Reactions In Medicine - Das Leistungsvermgen Der Wlzlager - Internationale Whrungsprobleme - Social Costs Of Energy - Water Analysis - Praxiswissen Umweltfreundliches Bauen - Kleists Geheimnisse - Drehschwingungen In Kolbenmaschinenanlagen Und Das Gesetz Ihres Ausgleichs - Die Tierwelt Der Alpen - Antarctic Nutrient Cycles And Food Webs - Dezentrales Vernetztes Energiemanagement - Angst Wegspielen - Annherung An Die Volkspartei - Die Tonuskrankheiten Des Herzens Und Der Gefsse - Transparenz In Arbeitsorganisationen - Wie Allein Sind Alleinerziehende - Distribution Und Handel In Theorie Und Praxis - Immunotherapeutic Prospects Of Infectious Diseases - Microcirculation In Circulatory Disorders - Authentische Aufgaben Im Theoretischen Bereich Von Instruktions- Und Lehr-lern-forschung - Eh-ph Diagrams For Geochemistry - Sap R3 Kommunikation Mit Rfc Und Visual Basic - Engineering Tables And Data - Computer Und Weltbild - Kommunalpolitik - Die Stdte In Den 90er Jahren - A Supply-side Agenda For Germany - Gesellschaftsbilder Im Umbruch - Der Fall Der Mauer - Allgemeine Und Spezielle Chirurgische Operationslehre - Rollenkonfigurationen Rollenfunktionen Und Gesundheit - Intracranial And Intralabyrinthine Fluids - Advances In Sociological Knowledge - Sozialpolitische Strategien Gegen Armut - Technische Berichte - Seniorenpolitik Aus Der Akteursperspektive - Nfstellige Funktionentafeln - Hautkrankheiten Und Syphilis Im Suglings Und Kindesalter - Musiksoziologie In Der Bundesrepublik Deutschland - Schlerinnen Und Schler Am Denkmal Die Ermordeten Juden Europas - Gesellschaft Im Wandel - Bibliographie Der Verffentlichungen Ber Den Leichtbau Und Seine Randgebiete Im Deutschen Und Auslndischen Schrifttum Aus Den Jahren 1940 Bis 1954 Bibliography Of Publications On Light Weight Constructions And Related Fields In German And Foreign Literature From 1940 To 1954 - Atlas Of Endoscopic Perforator Vein Surgery - Zwischen Sozialer Verantwortung Und Konomischer Vernunft - Kaiser Wilhelm Sein Leben Und Seine Zeit 17971888 - Global Environmental Security - Bankmarketing Im Firmenkundengeschft - Innere Sekretion Und Chirurgie - Mathematische Grundlagen Der Elektrotechnik - The Future Of Vocational Education And Training In A Changing World - Fachrechnen Metallberufe - Das Gesundheitswesen In Der Bundesrepublik Deutschland - Forschungsmanagement Steuerungsversuche Zwischen Scylla Und Charybdis - Akupressur Und Moxibustion - Perspectives In Turbulence Studies - The World Of Peptides - Petri-netze - Asphaltstrayen Und Teerstrayen - Parlamentarismus Im Zeitalter Der Europischen Integration - Keine Hochschule Den Sozialismus - Aufgaben Der Eisenbahn-politik - Demokratie Auf Dem Prfstand - Cultural Diversity In The Classroom - Loudspeaker Handbook - Der Phasenverschobene Strom - Der Darmverschluss Und Die Sonstigen Wegstrungen Des Darmes - New Directions For Operations Research In Manufacturing - Holznahrung Und Symbiose - Der Schlaf - Computer In Der Schule 3 - Eustachian Tube And Middle Ear Diseases - Vernunft Angesichts Der Umweltzerstrung - Elemente Der Funktionalanalysis - Die Gesammte Lehre Der Waldstreu Mit Rcksicht Auf Die Chemische Statik Des Waldbaues Unter Zugrundlegung Der In Den Knigl Staatsforsten Bayerns Angestellten Untersuchungen - Pflanzliche Stoffaufnahme Und Mikrobielle Wechselwirkungen In Der Rhizosphre - Die Stadt Der Zukunft - Was Jetzt - Kurze Einhrung In Die Physikalische Chemie - Social Costs Of Energy Consumption - Gewollte Und Ungewollte Schwankungen Der Weiblichen Fruchtbarkeit Bedeutung Des Kohabitationstermines Die Hufigkeit Der Knabengeburten - Manual Of Neonatal Respiratory Care - Habitusanalysis 1 - Lebenslanges Lernen Im Beruf Seine Grundlegung Im Kindes- Und Jugendalter - Die Kunst Der Klugheit - Geologie Mineralogie Und Lagerstttenlehre - Stichwort Wahlen - Der Fernsprechverkehr Als Massenerscheinung Mit Starken Schwankungen - International Yearbook Of Nephrology 1992 - Die Kausalitt Des Psychischen Prozesses Und Der Unbewussten Aktionsregulationen - Handbuch Informationsmanagement - Erwerbsttigkeit Und Familie In Steuer- Und Sozialversicherungssystemen - Der Rhein-nordsee-kanal - Afrika Jahrbuch 2000 - Wissenschaftsindikatoren - Soziale Werte Und Werthaltungen - Lagermetalle Und Ihre Technologische Bewertung - Crm Den Mittelstand - Wissenschaft Zwischen Folgenverantwortung Und Nichtwissen - Systems Theory And Biology - Die Erkrankungen Der Blutdrsen - Didaktik Beruflichen Lehrens Und Lernens - Hhere Mathematik Mit Mathematica - Morphometrie In Der Zyto- Und Histopathologie - Adaptations To Terrestrial Environments - Chemiker-taschenbuch - Die Denkform Der Alternative In Der Jurisprudenz - Recht Im Bereitschaftsdienst - Tunnel Und Verdeckte Kanle Im Netz - Der Versicherungsverkufer - Das Problem Des Charakteraufbaus - Cryotechniques In Biological Electron Microscopy - Grundriss Der Rntgentherapie - Pdagogik Der Massenkommunikation - Atlas Der Pulmonalen Funktionsdiagnostik - Das Englische Verwaltungsrecht Mit Einschluy Des Heeres Der Gerichte Und Der Kirche Geschichtsich Und Systematisch - Using Technology To Sell - Trends Of Economic Development In East Asia - Journalismus Als Beruf - Die Neue Kontinentalsperre - Metaphern Der ‚kur‘ - Starthilfe Finanz- Und Rechnungswesen - Nuclear Non-proliferation - The Effect Of Fluorine-containing Emissions On Conifers - Holding-strategien - Niklas Luhmanns Theorie Der Politik - Die Wiederentdeckung Der Diaspora - Grundkurs Politikwissenschaft Studium Der Politischen Systeme - Elitenvertrauen Und Demokratie - Student Participation In Online Discussions - –sterreich Zur Jahrhundertwende - Bees As Superorganisms - Handbuch Pdagogische Anthropologie - Einhrung In Die Roboterprogrammierung - „rger In Organisationen - Dosimetrie Der Strahlungen Radioaktiver Stoffe - Praktische Numerik Mit Mathematica - Mobilisierung Alle - Werte Wettbewerb Und Wandel - Kurze Geschichte Der Chirurgie - Einhrung In Die Lineare Algebra - Useful Plants Of Neotropical Origin - Trusts In Deutschland - Soziologische Ausflge - Das Gedingewesen Im Bergbau - Weltanschauliche Erziehung In Der Ddr - Verkehrsrecht Und Verkehrswirtschaft - Grenzgebiete Zwischen Psychiatrie Und Neurologie - Digitale Kommunikationsnetze - Reconsidering Archaeological Fieldwork - Famotidin Heute - Dementia In Clinical Practice A Neurological Perspective - Betrieb Und Anwendung Von Leistungs- Und Regeltransformatoren - Herzhypertrophie - Langzeitverlufe Und Sptresultate Bei Querschnittlhmung - Marketing Den Mittelstand - Verhrtete Fronten - Konstitutionspathologie In Der Ohrenheilkunde - Geschichte Der Politischen Bildung In Der Bundesrepublik Deutschland 1945 198990 - Der Kaprizise Ellbogen - The Human Sense Of Smell - Venous Valves - Klinische Rntgendiagnostik Des Dickdarms Und Ihre Physiologischen Grundlagen - Developments In Dairy Chemistry2 - Das Atom Und Die Bohrsche Theorie Seines Baues - Theoretische Atomphysik - Dokumentation In Der Mess- Und Prftechnik - Anleitungen Zum Arbeiten Im Elektrotechnischen Laboratorium - Neural Networks For Identification Prediction And Control - Bibliographie Der An Den Deutschen Technischen Hochschulen Erschienenen Doktor-ingenieur-dissertationen In Sachlicher Anordnung 1900 Bis 1910 - Bausteine Syntaktischen Wissens - Ion Implantation In Semiconductors - Beispiele Aus Der Baubetriebspraxis - Menschenrechte Und Europische Auyenpolitik - Der Umbau Des Sozialstaates - Das Management Von Stoffstrmen - Mixed Reality - Die Aktive Gesellschaft - Urate Deposition In Man And Its Clinical Consequences - Der Kampf Des Ingenieurs Gegen Erde Und Wasser Im Grundbau - Bericht Ber Den Viii Allgemeinen Deutschen Bergmannstag Zu Dortmund Vom 11 Bis 14 September 1901 - Service Ist Sexy! - Netzwerkanstze Im Business-to-business-marketing - Gleichstellungsorientierte Arbeit Mit Mdchen Und Jungen Frauen - Simulation Von Rhrenverstrkern Mit Spice - Mechanische Schwingungen Und Ihre Messung - Techniken Und Methoden Der Modernen Medizin - The Effects Of Cause-related Marketing On Customers Attitudes And Buying Behavior - 100 Jahre Bunsen-gesellschaft 1894 1994 - Digitales Fernsehen In Deutschland - Hmangiome - Marktstrategisches Kreislaufmanagement - Schein Common Sense Emergency Abdominal Surgery - Der Aufbau Der Materie - Einhrung In Die Medienwissenschaft - Militr Als Gegenkultur - Der Obama Impuls - Aufbruch Der Tchter Irans - Aktienrechtliche Jahresabschluyprfung - Cell Culture Techniques In Heart And Vessel Research - Frakturen Auf Einen Blick - Tunnelbaugeologie - Immediate-early Genes In The Central Nervous System - Die Hauptprobleme Der Modernen Astronomie - Die Jahr-2000-krise - Jugendtypen - Immuntherapie In Der Uroonkologie - Kombinationstherapie Der Herzrhytmusstrungen Mit Chinidin Und Verapamil - Einhrung In Die Chemische Physiologie - Efficient Usage Of Adabas Replication - Flow And Transport In The Natural Environment Advances And Applications - Tabubruch Als Programm - M©ni¨re Disease - Physik Der Teilchenbeschleuniger Und Synchrotronstrahlungsquellen - Nationalstaaten In Der Eu Identitt Und Handlungsmglichkeiten - Das Frben Von Papier - Der Bau Der Erde Und Die Bewegungen Ihrer Oberflche - Thromboseprophylaxe Bei Ambulanten Patienten Mit Gipsimmobilisation - Enzyme Handbook 4 - Arzneimittel Und Verantwortung - Demographische Analyse Und Populationsdynamische Modelle - Advances In Superconductivity Vi - Photonen - Die Energiefrage - Acht Jugendportrts - Das Pendeln Bei Gleichstrommotoren Mit Wendepolen - Rechtsquellen Zum Steuerstandort Liechtenstein - Cholecystokinin Antagonists In Gastroenterology - Numerische Methoden Im Cad - Psychopharmacogenetics - Die Grundlagen Der Erbbiologie Des Menschen - Knee Surgery - Nahost Jahrbuch 1999 - Die Berechnung Elektrischer Anlagen Auf Wirtschaftlichen Grundlagen - Krieg Als Medienereignis - Betrachtungen Ueber Abfluss Stau Und Walzenbildung Bei Fliessenden Gewaessern Und Ihre Verwertung Die Ausbildung Des œberfalles Bei Der Untertunnelung Der Sihl Durch Die Linksufrige Seebahn In Der Stadt Zrich - Kostenrechnung Sozialberufe - Grundriss Der Mykologischen Diagnostik - Aktuelle Therapie Gastrointestinaler Tumoren - Umweltschutz-management Und –ko-auditing - Primary Bone Tumors And Tumorous Conditions In Children - Glcksvorstellungen - Eisenguy In Dauerformen - Disney Stories - Stckkostenrechnung - Brain And Behavior In Child Psychiatry - Die Hollndische Landwirtschaft - Handbuch Der Modellstatik - Bedienung Und Schaltung Von Dynamos Und Motoren Sowie Kleine Anlagen Ohne Und Mit Akkumulatoren - Glck Und Zufriedenheit - Wer Dient Verdient! - Grundlagen Der Reprsentativen Statistik - Arbeitsmethoden Der Thermodynamik - Diffusion Und Globalisierung - Funktionentheorie - Felix Hausdorff Zum Gedchtnis - Interaction Between Mental And Physical Illness - Astrophotography - Chemical Water And Wastewater Treatment V - Null Zoff And Voll Busy - Empowering Open And Collaborative Governance - Angewandte Mathematik Modellbildung Und Informatik - Die Knstliche Seide - Technologie - Mechanoreceptors - Kosmetik - Surgery Of The Deep Femoral Artery - Improved Non-steroid Anti-inflammatory Drugs Cox-2 Enzyme Inhibitors - Die Deutsch-ostafrikanische Centralbahn - –kologische Kommunikation In Deutschland - Physik Im Experiment - Psychiatry And Philosophy - Microsurgery Of The Temporo-medial Region - Fuyball Verbindet - Durch Ausgrenzung - Staat Und Medien - Crossmedia-strategien - Trends In Applications Of Mathematics To Mechanics - Verminderung Des Verkehrslrms - Mechanische Verfahrenstechnik - Statistik Wirtschaftswissenschaftler - Bildungssysteme Und Soziale Ungleichheit - Interaktionsprofile - Gewaltdarstellungen In Den Medien - Wie Unternehmen Sich Selbst Erneuern - œbungsprogramm Zur Statistischen Methodenlehre - Einhrung In Die Entwicklungsphysiologie Des Kindes - Early Organic Evolution - Die Elektrogymnastik - Der Verzagte Staat Policy-analysen - Finanzausgleich Und Finanzbeziehungen Im Wiedervereinten Deutschland - Die Psychoanalyse - New Advances In Histamine Research - Physiotherapeutisches Rezeptierbuch - Jugendzeit Time Out - Ressourcenorientierte Netzwerkmoderation - Radiative Corrections For E+e- Collisions - Krebs Und Unfall - Stadt Und Soziale Ungleichheit - Essential Aspects Of Atopic Dermatitis - Grundlegende Algorithmen Mit Java - Insuring And Managing Hazardous Risks From Seveso To Bhopal And Beyond - Talent-management Spezial - Jugendliche In Japan Und Deutschland - The Company That Breathes - Biochemistry And Physiology Of Visual Pigments - Nuclear Technologies In A Sustainable Energy System - Modern Techniques In Computational Chemistry Moteccâ„¢ -89 - Konkrete Soziologie - Arztrecht - Theorien Gesellschaftlicher Differenzierung - Brgerschaft –ffentlichkeit Und Demokratie In Europa - Einhrung In Die Methoden Der Empirischen Soziologie - Grundlegung Der Lehre Vom Sozialen Verband - Black-box Models Of Computation In Cryptology - Die Prostitution Als Psychologisches Problem - Bildung Nachhaltige Entwicklung - Managing Business Portfolios Effectively - Bauelemente Und Grundschaltungen - Allgemeine Und Physiologische Chemie Der Fette Chemiker Mediziner Und Industrielle - Prominenz - Adolescent Gynecology - Quo Vadis Public Relations - Open Innovation In Life Sciences - Familientypen Und Formen Auyerfamilialer Kinderbetreuung Heute - Analytical Methods In Software Engineering Economics - Die Spt-renaissance Kunstgeschichte Der Europischen Lnder Von Der Mitte Des 16 Bis Zum Ende Des 18 Jahrhunderts - Konstanten Der Atomphysik - Die Psychologischen Probleme Der Industrie - Soziale Kontrolle - Orbital Symmetry And Reaction Mechanism - Theorie Der Medizinischen Informatik - Bilder Der Arbeit - Chemische Funktionslehre - Simultaneous Engineering - –konomische Probleme Des Zivilrechts - Wohlfahrtskulturen In Frankreich Und Deutschland - Mglichkeiten Und Grenzen Der Frderung Verantwortlichen Handelns Von Wirtschaftsprfern In Moralisch Relevanten Situationen - A Safer Death - Nucleic Acids In Immunology - Atlas Of Scrotal Ultrasound - Zweckrationalitt Und Strafrecht - Versicherungsbetrug Verstehen Und Verhindern - Aufgaben Politischer Bildung In Der Sekundarstufe I - Technologische Grundprozesse Der Vakuumelektronik - Einhrung In Die Programmiersprache C++ - European Perspectives On Taiwan - Self Ego And Identity - Mathematics Today Twelve Informal Essays - Mythen In Der Politik Der Ddr - Mathematische Analyse Des Raumproblems - Satellite Communications - Recursive Block Coding For Image Data Compression - Small Talk Und Karriere - Politische Soziologie - Metallkleben - Principles And Management Of Adrenal Cancer - Vertrauen Und Glaubwrdigkeit - Java 7 Recipes - Forstliches Rechnen - A Strategic Fit Perspective On Family Firm Performance - Lehrbuch Der Histologie Und Der Mikroskopischen Anatomie Des Menschen - Funktionsprufung Innerer Organe - Die Grundzge Der Werkzeugmaschinen Und Der Metallbearbeitung - Die Interaktionsordnung Von Personalhrung - Jugendunruhen Und Protestbewegungen - Finite Element Methods For Nonlinear Problems - Vom Medienkind Zum Kinderstar - Ingenieur-mathematik - Der Junge Drogist - Sehen Und Erkennen - Technische Gebudeausrstung - Das Reichsgesetz Betreffend Den Ausbau Der Deutschen Wasserstrayen Und Die Erhebung Von Schiffahrtsabgaben Vom 24 Dezember 1911 - Die Arbeitenden Klassen Englands - Die Vitale Bank - Lean Production - Grundkurs Mediengestaltung - Erklrungsnotstand Altersvorsorge - Globalisierung Stadtrume Und Lebensstile - Vorteilhaftigkeit Zwischen Leasing Und Kreditfinanziertem Kauf - Elektronische Datenverarbeitung - Arbeitsbuch Zur Produktionspolitik - Die Konomische Dynamik Politischer Herrschaft - Advertisers At Work - Einhrung In Die Technische Strmungslehre - Qualitt In Der Medizin Dynamisch Denken - Heidelberg Congress On Taxing Consumption - Herz- Und Kreislauferkrankungen Im Alter - Morphological Astronomy - Die Krankenpflege In Der Chirurgie - Starthilfe Elektrotechnik - Kommunikationsberatung Und Kommunikationstraining - Der Harn Sowie Die Brigen Ausscheidungen Und Krperflssigkeiten - Masterkurs Kostenstellenrechnung Mit Sap - Fortschritte Der Theerfarbenfabrikation Und Verwandter Industriezweige - Adapted Physical Activity - Arzt Aus Leidenschaft - Die Maschinenelemente - Familie Arbeit Kinderbetreuung - Improving Soil Fertility Recommendations In Africa Using The Decision Support System For Agrotechnology Transfer Dssat - Aneignung Und Interkulturelle Reprsentation - Vorschriftsgemyes Entwerfen Nach Bauordnungen Normen Richtlinien Und Regeln - Lumbar Spine Syndromes - Progress In Pacific Polymer Science 2 - Wendehorst Bautechnische Zahlentafeln - Integriertes Geschftsprozessmanagement - Distributed Autonomous Robotic Systems - Elemente Des Vorrichtungsbaues - Die Aromatischen Arsenverbindungen - Blcke Und Kokillen - Thallium Myocardial Perfusion Tomography In Clinical Cardiology - Information Strategy Design And Practices - Reengineering Fluch Oder Segen - Kommentar Zur Vorlufigen Landarbeitsordnung Vom 24 Januar 1919 Nebst Einem Abdruck Der Bestimmungen Ber Die Anwerbung Und Beschftigung Auslndischer Arbeiter - Lie-gruppen Und Lie-algebren - Grundmuster Visueller Kultur - Jungquartre Landschaftsrume - Region Und Nation - Niklas Luhmann Beobachtet - Green Solvents Ii - Therapie Und Prvention Mit Kalziumantagonisten - Regionale Analyse Mit Kleinen Gebietseinheiten - Das Photographische Objektiv - Junge Frauen Heute Wie Sie Leben Was Sie Anders Machen - Das Prometheus-projekt - Sandstone Depositional Models For Exploration For Fossil Fuels - Das Rntgenbild Des Schdels Bei Intrakranieller Drucksteigerung Im Wachstumsalter - Lehrbuch Der Diathermie - Der Bundesprsident Im Politischen System - Soziale Lage Und Lebensstil - Energie- Und Klimaeffiziente Produktion - Leime Und Kontaktkleber - Das Skizzieren Ohne Und Nach Modell Maschinenbauer - Gesellschaft Und Tiere - Scientific Visualization - Verkehrsformen Und Schreibverhltnisse - Madagaskar - Von Makis Und Menschen - Stochastische Signale - Sicherheit Durch Gemeinschaft - Pedophilia - Urologische Endokrinologie - Lebensstile Durch Werbung - Von Der Abfallwirtschaft Zur Kologischen Stoffwirtschaft - Die Zweite Lebenshlfte - Cure Of Thermosetting Resins - Systemwechsel 4 - Das Erwerbsverhalten Von Frauen In Der Intensiven Familienphase - Transnationale Konzerne Im Weltsystem - Schritte Zum Nachhaltigen Unternehmen - Bevlkerungsentwicklung Rentenfinanzierung Und Einkommensverteilung - Perspektiven Der Kultursoziologie - Von Der Diktatur Zur Demokratie - Umweltbewuytsein - Cordless Telecommunications In Europe - Heilpdagogik - Die Technik Des Bankbetriebes - Die Arbeitszeitermittlung Der Verzahnungsarbeiten - Рост Кристаллоь Rost Kristallov Growth Of Crystals - Fertigungsvorbereitung Als Grundlage Der Arbeitsvorbereitung - Leitgedanken Einer Neuzeitlichen Werkstoff-forschung - Der Wrmebergang An Strmendes Wasser In Vertikalen Rohren - Das Blech Und Seine Prfung - Die Digitale Revolution - Medikamentse Krebsbehandlung - Essener Beitrge Zur Empirischen Wirtschaftsforschung - Kants Friedensschrift Und Der Theorienstreit In Den Internationalen Beziehungen - Bauordnung Berlin - Auftrags- Und Projektmanagement - Leitfaden Der Rundfunkentstrung - Die Technische Mechanik Des Maschineningenieurs Mit Besonderer Bercksichtigung Der Anwendungen - Professionelles Zeitmanagement - Parallele Digitale Optische Recheneinheiten - Beitrge Zur Kenntnis Der Tsetsefliege Glossina Fusca Und Gl Tachinoides - Generation Und Gedchtnis - C Unter Unix - Vergesellschaftung Des Regierens - Junge Technologieunternehmen - Applied Multivariate Statistics In Geohydrology And Related Sciences - Das Schielen - Diseases Of The Human Carotid Body - Recht Und Tabu - Professionelle Verkaufsprsentation - Vergleichen In Der Politikwissenschaft - œberlebensstrategien Hrungskrfte - Kollektive Identitt In Krisen - Das Letzte Jahr Der Sowjetunion - Vertrauenskrise - Wealth Manager Was Nun - Ausbildungskompass Bankkaufleute - New Methods Of Thought And Procedure - Handbuch Der Rehabilitationspsychologie - Automation In The Food Industry - Die Statik Im Stahlbetonbau - Fachinformation Online - Symbolische Politik Der Vereinten Nationen - Die Bewltigung Des Unplanbaren - Fraktale Geometrie Eine Einhrung - Schdliche Nebenwirkungen Von Arzneimitteln - Die Elektromotren In Ihrer Wirkungsweise Und Anwendung - Frischoperiertenstation Und Intensivpflege - Niedrigdosisstrahlung Und Gesundheit - Digitaltechnik - Private Schulen In Deutschland - Hilfsbuch Mineralltechniker Stoffkonstanten Und Berechnungsunterlagen Apparatebauer Ingenieure Betriebsleiter Und Chemiker Der Minerallindustrie - Optical Information Processing - Migrantenjugendliche Zwischen Schule Und Beruf - At1-rezeptorantagonisten - Der Vernetzte Konsument - Dark Matter In The Universe - Information Zwischen Interpretation Und Kritik - Der Flug Der Tiere - Agil Macht Stabil - Weberei - Handbuch Der Rohrleitungen - Eine Konomische Analyse Der Mediendemokratie - Elektrische Maschinen Der Kraftbetriebe - Wirtschaftsjournalismus - Glcksspiel - Chernobyl - Die Zukunft Kommt Wohin Geht Die Wirtschaft - Biomasse - Almanach Der Praktischen Ethik - Die Klassischen Sttten Von Jena Und Jlmenau - Elektro-werkzeuge Kleinwerkzeugmaschinen Mit Einbaumotor Und Biegsame Wellen - Die Hochspannungsfreileitung - Ordnungsmacht Psychiatrie - Ein Haus In Europa - Erweiterte Datenanalyse Mit Spss - Prozessregulation In Der Rhizosphre - Ganztagsschule - Nationale Identitt Und Staatsbrgerschaft In Den Usa - Wie Beurteilt Man Eine Bilanz - Die Pubertt - Allgemeine Diagnostik Und Therapie Der Hautkrankheiten - Hinzunehmende Unregelmyigkeiten Bei Gebuden - Due Diligence In Der Praxis - Controlling Von Projekten - Ethikberatung In Der Medizin - Bacteria In Agrobiology Plant Probiotics - Jugend-gewalt - Fremdenfeindlichkeit Als Medienthema Und Medienwirkung - Pediatric Ultrasonography - Bildungserfahrungen An Waldorfschulen - Relativistic Quantum Mechanics - Das Elite- Missverstndnis - Grundkurs Mysql Und Php - Pain And Kampo - Op-pflege Prfungswissen - Physical Approaches To Biological Evolution - Wertewandel - Intellektuelles Kapital Und Wettbewerbsfhigkeit - Adaptiogenese Und Phylogenese - Winner Edge Konzepte Vorsprung - Marktwirtschaft In China - Der Mensch In Der Psychiatrie - Abwanderung Geburtenrckgang Und Regionale Entwicklung - Advances In Clinical Neuropsychology - Deutsches Leben Zur Zeit Der Schsischen Kaiser - Management Kreativer Prozesse - Gabler Banklexikon - Esd The Scourge Of Electronics - Wege Aus Der Ausbildungskrise - Windows Phone Recipes - Der Streit Um Die Hochschulrahmengesetzgebung Des Bundes - Handbuch Frhkindliche Bildungsforschung - Lost Brands - Vom Aufstieg Und Niedergang Starker Marken - Der Chirurgische Operationssaal - Zirkulre Positionen - Klinik Der Missbildungen Und Kongenitalen Erkrankungen Des Ftus - Aging And Life-prolonging Processes - Female Contraception - Ressourcenorientiert Arbeiten - Veins - Personenbezogene Soziale Dienstleistungen - Die Bestimmung Der Vaterschaft - Organisations-intelligenz Iq - Eifersucht Bewltigen - Quantum Electrodynamics - Technischer Lehrgang Kupplungen - Bone Metastases - Alcohol Metabolism Alcohol Intolerance And Alcoholism - Energie Die Zukunft - Central Nervous System Monitoring In Anesthesia And Intensive Care - Objektorientierte Programmierung In Java - Modern Triz - Umweltgeochemie - A Course In Mathematical Physics 1 - Didaktische Probleme Der Elementaren Algebra - Dampferzeugung Dampfkessel Feuerungen - Paradigmen Der Bewegungsforschung - Applied Stochastic System Modeling - Bankwirtschaft Rechnungswesen Und Steuerung Wirtschafts- Und Sozialkunde - Innovatives It-management - Der Januskopf Der Prominenz - 25 Deutscher Soziologentag 1990 Die Modernisierung Moderner Gesellschaften - Glubigerstrategien Im Schuldnerkonkurs - Contributions To A Computer-based Theory Of Strategies - Fouriertransformation Fuygnger - Elektromagnetische Vertrglichkeit - Organisationsmanagement Internationaler Unternehmen - Schlkes Tafeln - Hhere Analysis Mit Derive - Sexual Reproduction In Higher Plants - Die Wissenschaftliche Und Angewandte Photographie - Adsorption Of Organic Compounds On Electrodes - Global Interdependence - Die Gleichstellung Von Frauen Und Mnnern In Der Europischen Arbeitswelt - Hochschulreform In Europa Konkret - Stressbewltigungstraining Erwachsene Mit Adhs - Moderne Mythen Der Medizin - Die Entwicklung Des Menschen Vor Der Geburt - Modernisierung Personenorientierter Dienstleistungen - Demokratie Und Partizipation - Die Chirurgie Der Handverletzungen - Raumforderungen Der Niere Im Sonographischen Bild - Baubetriebslehre - Projektmanagement - Anlay- Und Regelwiderstnde - Die Erfindung Der Balkanvlker - Parteijugend In Deutschland - Soziologische Theorie Der Gegenwartsgesellschaft - Arbeitswissenschaft Im Nationalsozialismus - Einhrung In Die Soziologie Der Behinderung - Dv-projektrecht - Differential Geodesy - Cognitive Screening Instruments - Rechtsgrundlagen Des Architekten Und Ingenieurs - Traumatologie In Der Chirurgischen Praxis - Schlkes Formeln - Betriebliches –kocontrolling - Rettung Eines Flusses - Geschlecht Ethnizitt Klasse - Der Mensch Als Soziales Wesen - Arbeit In Interkulturellen Teams - Advances In Corrosion Science And Technology - Dynamic Capabilities Als Einflussfaktoren Des Markteintrittstimings - Charakter Und Nervositt - Orthopdischrheumatologische Kurmedizin - Erfindung Und Nachahmung - Prvention Von Jugendgewalt - Hochfrequenzmeytechnik - Maple V Language Reference Manual - Die Strafe I - Fremde Als Ordnungshter - Alterspsychotherapie Quo Vadis - Vertriebscontrolling Optimieren - Schwarzbuch Soziale Arbeit - Studien Zu Gemeinschaft Und Gesellschaft - Betriebswirtschaftliche Fallstudien - Die Polysaccharide - Wir Sind Die Marsmenschen - Die Physikalischen Und Technischen Grundlagen Der Hochfrequenzbehandlung - Rasse Und Ethnizitt - Percutaneous Lumbar Discectomy - Nachhaltiges Vertriebscontrolling Elektrotechniker - Lehrbuch Der Pflanzenkrankheiten - Arbeitsbltter Friseure - Automobilrecycling - Erfahrung Und Technik In Der Produktion - Die Fichte In Bezug Auf Ertrag Zuwachs Und Form - Kommentar Atv Din 18 350 Und Din 18 299 - Das 1 — 1 Erfolgreicher Verkufer - Quantenbiologie - Die Knochenbrche Und Ihre Behandlung - Erfolgreiche Anzeigen - Zytologie Der Nasenschleimhaut - Die Widerstandsfhigkeit Von Dampfkesselwandungen - Kurzer Leitfaden Der Elektrotechnik In Allgemeinverstndlicher Darstellung Unterricht Und Praxis - Die Analyse Sozialer Ungleichheit - Jahresbericht Ber Die Beobachtungs-ergebnisse - Die Methode Der Festpunkte Zur Berechnung Der Statisch Unbestimmten Konstruktionen Mit Zahlreichen Beispielen Aus Der Praxis Insbesondere Ausgehrten Eisenbetontragwerken - Judith Butler Pdagogische Lektren - Sprachwandel Durch Computer - Structural Safety Evaluation Based On System Identification Approaches - Demokratie Lernen Im Alltag - Grundkurs Regelungstechnik - Bakterielle Erkrankungen Der Kulturpflanzen - Sexualmoral Und Zeitgeist Im 19 Und 20 Jahrhundert - Konservative Und Operative Orthopdie - Handbuch Der Gieyerei-technik - Social Dilemmas And Cooperation - Urosonographische Differentialdiagnose - Die Konstruktion Des Kindes - Mind The Gap! - Die Trken Die Deutschen Und Europa - Herausforderungen Der Wirtschaftsinformatik - Die Integration Von Theorie Und Methode In Der Netzwerkforschung - Von Cim Zur Unternehmensintegration - Telephone Surveys In Europe - Allgemeine Wirtschaftslehre Industriekaufleute - Monoclonal Antibodies - Aachener Bausachverstndigentage 2005 - Die Wirkung Verbaler Und Nonverbaler Kommunikation In Tv-duellen - Plant Growth Substances 1988 - Mri Atlas Of Central Nervous System Tumors - Objektorientierte Software In Der Kommerziellen Anwendung - Einhrung In Die „protestantische Ethik Max Webers - Geschlechter - Corporate Reputation Management - Issues In Software Engineering Education - Erfolgreich Projekte Leiten - Die Produktion Zentraler Ffentlicher Rume In Der Aufmerksamkeitskonomie - Comparative Mammalian Cytogenetics - Deskriptive Statistik Und Moderne Datenanalyse - Ergebnisse Und Probleme Der Elektronentheorie - Im Widerstreit - Bildungslandschaften - Biometrie - Friedensengel Im Kampfanzug - Ost-west-sprachgebrauch Zehn Jahre Nach Der Wende - Biology Of Desert Invertebrates - Materialtheorie - Water And Life - Lernort Kinderfreunde - Einhrung In Die Koordinationschemie - Handbook Of Parathyroid Diseases - Gas Flow And Chemical Lasers - Fotochemikalien - Die Besten Den Vertrieb - Stahlbetonbau Nach Din 1045-1 - Macht Und Wandel Die Beziehungen Der Usa Zu Mexiko Und Brasilien - Vom Chaos Zum Konsens - Kommentar Zu Dem Gesetz Ber Den Verkehr Mit Betubungsmitteln Opiumgesetz Und Seinen Aushrungsbestimmungen - Physik Der Ferrite Und Der Verwandten Magnetischen Oxide - Platow Prognose 2010 - Parkinson Disease - Proceedings Of The Third Conference On Mechatronics And Robotics - Paediatric Pathology - Netzarchitektur Kompass Die Realisierung - Anleitung Zur Quantitativen Bestimmung Der Organischen Atomgruppen - Automaten - Die Chemischen Und Physikalischen Prfungsmethoden Des Deutschen Arzneibuches 6 Ausgabe - Die Schaltungsarten Der Haus- Und Hilfsturbinen - Harmonisierung Demographischer Und Sozio-konomischer Variablen - Handbuch Der Internationalen Politik - Bauvertragsrecht - Advances In Molten Salt Chemistry - Der Arbeiterschutz In Den Preussischen Bergpolizeiverordnungen - Modern Clinical Molecular Techniques - Language Engineering - Die Fernrohre Und Entfernungsmesser - Der Konstruktive Fortschritt - Massen-tafeln Zur Bestimmung Des Gehaltes Stehender Bume An Kubikmetern Fester Holzmasse - Stabilitt Und Transformation Politischer Systeme - Jugendkonsum Im 21 Jahrhundert - Handbuch Der Metallmrkte - Von Der Erkenntniskritik Zur Kritischen Theorie Der Gesellschaft - Sozial- Und Wirtschaftspolitik Unter Rot-grn - Georgius Agricola 500 Jahre - Laser In Forschung Und Technik Laser In Research And Engineering - –ffentliche Meinung Und Politik - Von Der Kundenorientierung Zum Supply Management - Musikfernsehen In Deutschland - Schulwesen Und Organisation - œbertragungsverhalten Analoger Schaltungen - Mergers And Acquisitions Im Mittelstand - Die Zukunft Der Automobilindustrie - Frankreich-jahrbuch 2002 - Offshore Structures - Soziologischer Funktionalismus - Wages Regime Switching And Cycles - Medienjournalismus - Praxisfeld Hilfe Zur Erziehung - Lunge-berl Chemisch-technische Untersuchungsmethoden - Controlling-praxis Erfolgreicher Unternehmen - Die Selbstttige Regelung - Grundzge Der Bergbaukunde Einschliesslich Aufbereitung Und Brikettieren - Grundkurs Biomathematik - Grundlagen Der Allgemeinen Und Speziellen Arzneiverordnung - Richard Dedekind 18311981 - Der Betriebs-chemiker - Brcken - Zwischen Zwang Und Freiwilligkeit - „nicht So Wie Unsere Eltern! - Evolution Of Information Processing Systems - Psychotherapeutische Interaktion - Ajcc Cancer Staging Atlas - Nfstellige Logarithmische Und Trigonometrische Tafeln - Bankenaufsicht - Grundlagen Des Marketing - Manfredo P Do Carmo Selected Papers - Handbuch Fernsehforschung - Pro Web Project Management - Wege Zum Raum - Baustoffchemie - Aufstand Der Palstinenser Die Intifada - Das Politische System Ungarns - Kaffee Und Koffein - Kabel-herstellung - Public Marketing - Der Getreideterminhandel In Deutschland Vor Und Seit Der Reichsbrsengesetzgebung - Transformationen Und Signale - Ersticken - Das Geteilte Leben - Jenseits Von Identitt Oder Integration - Lectins And Glycoconjugates In Oncology - The Phenomenological Theory Of Linear Viscoelastic Behavior - Bericht œber Die Siebenundvierzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1928 - Operations Research Im Bauwesen - Einhrung In Den Eurocode 3 - Strukturformen Und Funktionsleistungen Sozialer Systeme - Erzieherinnen In Beruf Und Freizeit - Vob Bildband - Die Lehre Von Den Pupillenbewegungen - Die Psychosoziale Situation Von Auslndern In Der Bundesrepublik - Energieeffizienz Und Energiemanagement - Nachhaltigkeit - Konsensus Und Interessen - Wertorientierung Und Zweckrationalitt - Unternehmenshrung Und Kapitalmarkt - Krpermass-studien An Kindern - Modern Geometric Computing For Visualization - Stadtregion Und Wissen - Pflege Alter Menschen Als Beruf - Neutrino Physics - Das Kuratorium Unteilbares Deutschland - Rechtssoziologie - The Measurement Of Turbulent Fluctuations - Projektmanagement Der Sw-entwicklung - Teilchenphysik Aus Heutiger Sicht - Arterial Grafting For Myocardial Revascularization - Das 1 X 1 Des Wissenschaftlichen Arbeitens - Ausschreibungshilfe Auyenanlagen Und Tiefbau - Kernreaktortheorie - Praxiswissen Radar Und Radarsignalverarbeitung - Instrumental Methods And Scoring In Extrapyramidal Disorders - Soziale Stadt Sozialraumentwicklung Quartiersmanagement - Volume 1 Modern Electrochemistry - A Course In Mathematical Physics 3 - Technischer Lehrgang Hydraulik - Selbstorganisation Verantwortung Gesellschaft - Medienwelten Im Wandel - Building Global Security Through Cooperation - Export Consortia In Developing Countries - Interaction Evolution And Chaos In Space - Wasserbau Und Wasserwirtschaft In Deutschland - Bilanzanalyse Und Bilanzkritik - Die Heizerschule - Parteienwettbewerb In Den Deutschen Bundeslndern - Aneurysmen Der Thorakalen Aorta - Handbuch Der Hartmetallwerkzeuge - œberlebt Die Soziale Stadt - Pathologische Histologie - Single-channel Recording - Die Mission Des Mzens - Einhrung In Die Festigkeitslehre - Der Landwirtschaftliche Kredit Und Seine Durchgreifende Verbesserung - Lebenslufe Hben Und Drben - Gestational Diabetes - Lehrbuch Der Zahnheilkunde - Phytopharmaka Ii - Starthilfe Graphikfhige Taschenrechner Und Numerik - Mental Health Outcome Measures - Laser Lithotripsy - Gesellschaftliche Konstruktion Von Minderheiten - Diagnostik Der Kinderkrankheiten Mit Besonderer Bercksichtigung Des Suglings - Advances In Manufacturing Technology Ii - Wrterbuch Der Kraftbertragungselemente Diccionario Elementos De Transmisi³n Glossaire Des Organes De Transmission Glossary Of Transmission Elements Glossario Degli Organi Di Trasmissione Glossarium Voor Transmissie-organen Ordbok Fr Transmissionselement Voimansiirtoalan Sanakirja - Gerechtigkeit - Entwicklung Paralleler Betriebssysteme - Das Vieweg Einheiten-lexikon - Lehrbuch Der Geisteskrankheiten - The Art Of Accompanying And Coaching - Erluterungen Zu Den Sicherheitsvorschriften Die Errichtung Elektrischer Starkstromanlagen Einschliesslich Der Elektrischen Bahnanlagen - Die Grenzen Der Wirtschaftspolitik - The Central Nervous System In Aids - Die Beobachtung Von Kommunikation - Demokratien Des 21 Jahrhunderts Im Vergleich - Hair Replacement Surgery - Power In Procurement - Die Planungszelle - Digitale Subtraktionsangiographie In Klinik Und Praxis - Das Strahlungsklima Von Arosa - Aktuelle Neuropdiatrie 1988 - Idiopathic Dilated Cardiomyopathy - Das Berufsbildungssytem In Deutschland - Chemie Des Ingenieurs - „sthetik Im Prozey - Die Lebensstilgesellschaft - Demokratiequalitt In –sterreich - Theoretical Physics On The Personal Computer - Software Engineering Economics And Declining Budgets - Aachener Bausachverstndigentage 2011 - Urbaner Bodenschutz - Dynamik Der Baukonstruktionen - Rechnungslegung Nach Neuem Recht - Cobol - Plant Viruses - Abgrenzung Und Bewertung Von Vermgensgegenstnden - Geschlechterdemokratie - 40 Jahre Kardiologie An Den Universittskliniken Des Saarlandeshomburg 1959 1999 - Grundriss Des Kaufmnnischen Rechtes - –kologisches Arbeiten - Aktuelle Probleme Der Klinischen Strahlenbiologie - Drogenkonsum Und -kontrolle - Assembler- Programmierung Mit Dem Pc - Peptides - Intensivmedizinische Praxis - Essential Hypertension 2 - Bioastronomie - Zeiss Microscopes For Microsurgery - Grundriy Einer Meteorobiologie Des Menschen - Kurze œbersichtstabelle Zur Geschichte Der Medizin - Die Wirthschaftliche Einteilung Der Forsten Mit Besonderer Bercksichtigung Des Gebirges In Verbindung Mit Der Wegenetzlegung - Eine Einladung In Die Mathematik - Der Wrmeaustausch Im Festen Erdboden In Gewssern Und In Der Atmosphre - Unternehmenshrungslehre - Eliten In Deutschland - Nachrichtensysteme Dienstintegration In Knftigen Kommunikationsnetzen - Das Maschinen-zeichnen - Bakteriologische Diagnostik - Rational Choice Und Theoriegeleitete Evaluationsforschung - Wege Zum Sozialen - Gene Transfers And Environment - Die Kondensation Der Dampfmaschinen Und Dampfturbinen - Freizeit In Der Erlebnisgesellschaft - Lehrbuch Der Pflanzenphysiologie - Festverzinsliche Optimal Managen - Endstation Amerika - Der Semidnnschnitt - Alterssicherung Von Frauen - Die Reduktion Der Eisenerze - Fertigungsleitsysteme - Ethikbasierte Unternehmenshrung Und Commitment Der Mitarbeiter - Hrungsinstrument Kommunikation - Der Islamische Fundamentalismus Der Islam Und Die Demokratie - Die Periphere Schmerzauslsung Und Schmerzausschaltung - Arthritis And Related Affections - Einzelkosten- Und Deckungsbeitragsrechnung - Kreditpolitik - Sensoren Die Prozess- Und Fabrikautomation - Red Cell Shape - Schnittanatomie Des Menschlichen Gehirns - Die Rede Des Kanzlers - Biology Of The Vespine Wasps - Einhrung In Die Psychotherapie Medizinstudierende Und „rzte - Platow Prognose 2009 - Betriebliche Rationalisierung Und Konomische Rationalitt - Finite-elemente-methode - Strahlungsquellen Technik Und Medizin - Die Elektrische Futterkonservierung - Asl Portable Programmierung Massiv Paralleler Rechner - Der Apotheker Im Spiegel Der Literatur - Suburbanisierung In Deutschland - Grundzge Der Zhlertechnik - Dermatology In Five Continents - Kollegialitt Und Kooperation In Der Schule - Hhere Mathematik Griffbereit - Von Der Karitativen Sorge Zum Rztlichen Selektionsblick - Die Halboffenen Anstalten Kleinkinder - Practical Sharepoint 2010 Information Architecture - War Der Wissenschaftliche Kommunismus Eine Wissenschaft - Die Rztliche Ausbildung In Der Europischen Gemeinschaft - Wozu Politische Theorie - Elektrokonvulsionstherapie Kompakt - Arbeitsbltter Friseure 1 - Coma And Disorders Of Consciousness - Strukturwandel Internationaler Beziehungen - Vermessungskunde 1 - Aufschwung Ost - Eigenwilligkeit Und Rationalitt Sozialer Prozesse - Eine Blhende Psychiatrie In Gefahr - Unter Der Brcke Rechts - Starthilfe Strmungslehre - Food Webs - Festigkeitsberechnung Rotierender Scheiben - Advanced Methods Of Physiological System Modeling - Progress In Regional Cancer Therapy - Parametric Optimization Singularities Pathfollowing And Jumps - Kommentar Zur Schiedsgerichtsordnung Das Bauwesen - Petroleum Formation And Occurrence - Spte Mtter - Kriminalitt - Primate Vocal Communication - Hrt And Osteoporosis - Survival-guide Chirurgie - Arzneistoffe - Progress In Advanced Structural And Functional Materials Design - Mathematica In Der Theoretischen Physik - Die Behandlung Der Haut- Und Geschlechtskrankheiten In Der Sprechstunde - Repetitorium Funktionentheorie - Europapolitik Der Deutschen Lnder - Von Der Arbeitserfahrung Zum Arbeitsprozeywissen - Sinn-management - Brauchen Wir Einen Neuen Gesellschaftsvertrag - International Skeletal Society Membership Book - Das Prostatakarzinom - Bone Circulation And Bone Necrosis - Kulturen Vergleichen - Berichte Des Ausschusses Versuche Im Eisenbau Ausgabe B - Jugend Arbeit Und Interessenvertretung In Europa - Entwicklung Und Gegenwrtiger Stand Der Kokereiindustrie Niederschlesiens - Psychodrama Und Gesellschaft - Vibration And Coupling Of Continuous Systems - Politikwissenschaftliche Methoden - –kologische Stadtentwicklung - Die Stadt Das Fremde Und Die Furcht Vor Kriminalitt - Die Stimme Der Medien - Perinatal Retinal Haemorrhages - Starthilfe Pharmakologie - Kinderradiologie 2 - The Ichthyoses - Chemie Des Bauwesens - Transition Metals And Organometallics As Catalysts For Olefin Polymerization - Fertigungstechnik Von Luft- Und Raumfahrzeugen - Lebensstil Und Mortalitt - Journalisten Im Netz - Parteienfinanzierung - Finanzmathematik - Handbuch Der Chemisch-technischen Apparate Maschinellen Hilfsmittel Und Werkstoffe - Ostdeutsche Jugendliche - Theoretische Biochemie - Tragwerksdynamik - Regionale Governance Des Funktionswandels Von Flughfen - Elementare Stochastik - Kinder- Und Jugendarbeit Als Bildungsprojekt - Hre Dich Selbst - Der Neuzeitliche Aufzug Mit Treibscheibenantrieb - Leitbilder Von Gestern - Coronary Circulation - Mobilitten In Europa - Smarte Innovation - Vermarktung Des Spitzenhandballs - Internationale Rechnungslegung - Buchhrung Technik Und Praxis - Kundengesprche Souvern Meistern - Ultradian Rhythms In Life Processes - Pseudopotentiale - „ich Wnschte Ich Wre Glubig Glaub Ich - Introduction To Mathematical Logic - Kapitalismus Und Sozialismus - Statistische Methode Die Zuverlssigkeitsanalyse - Sich Zeigen Und Die Welt Zeigen - Essays On Production Theory And Planning - Analysis Mit Mathematica Und Maple - Grundlagen Der Geometrischen Datenverarbeitung - Versprechungen Des „sthetischen - Contemporary Research Methods In Neuroanatomy - Emotion Gesellschaft Und Kultur - Bedrfnis Und Befriedigung - Integrale Infrastrukturplanung - Das Trockengleichrichter-vielfachmeygert - Anorganische Strukturchemie - Grne Gentechnik - Gestaltungschance Und Entwicklungsrisiko - Die Frau - Medien-mythos - Zwischen Lust Und Frust Jugendsexualitt In Den 90er Jahren - Die Nebennierenrinde Im Kindesalter - Best Practice In Einkauf Und Logistik - Gehirn Und Rckenmark - Kooperation Im Niemandsland - Arterial Variations In Man - Technikfolgenforschung Und Technikfolgenabschtzung - Einhrung In Die Kryptologie - Demokratische Perspektiven In Der Pdagogik - Der Ausgleich Des Gebirgsdruckes In Groyen Teufen Beim Berg- Und Tunnelbau - Einhrung In Die Elektrische Messtechnik - Einhrung In Die Quantenmechanik Und Ihre Anwendungen - Spannweite Der Gedanken - Die Kalkulation Im Schmiedegewerbe - In Deutschland Zu Hause - Nondestructive Evaluation Of Materials By Infrared Thermography - Deutsche Familiensoziologie - Starthilfe Pharmazie - Viral Hepatitis And Liver Disease - Sandostatin In The Treatment Of Acromegaly - Die Blutgruppen Und Ihre Anwendungsgebiete - Hebammen-lehrbuch - Mehrgryenregelungen - Praktische Duplexsonographie - Innovation In Der Betriebswirtschaftslehre - Principles Of Turbomachinery - Die Kohlenstoffernhrung Des Waldes - Sozialismus Und Nation - Thermoregulation Of Sick And Low Birth Weight Neonates - Die Physiologische Entwicklung Des Kindes - Rechtsgrundlagen Den Bankkaufmann - Die Brennstoffe - Lehrbuch Der Hochbaukonstruktionen - Grundlegende Begriffe Der Mathematik Entstehung Und Entwicklung - Symmetries In Physics - Obstetric Fistula - Grundkurs Computergrafik Mit Java - Die Verstimmte Demokratie - Virtuelle Wirtschaft - Forschungsprojekte Und Forschungsprogramme - Wiederkehr Des „volksgeistes - Grundlagen Der Astrophysik - Der Bauingenieur In Der Praxis - Essays In The History Of Mechanics - Form Und Funktion Sozialer Netzwerke In Wirtschaft Und Gesellschaft - Grundlagen Der Cmos-technologie - Diseases Of The Salivary Glands Including Dry Mouth And Sjgren Syndrome - We Are The Martians - Die Dampflokomotive - Parteienwettbewerb Im Bundesstaat - Rotordynamics Of Automotive Turbochargers - Die Geschichte Der Frauenbewegung In Deutschland - Empirische Policy- Und Verwaltungsforschung - Die Japanischen Manager - Tatort Schule Gewalt An Schulen 19941999 - Myelin Repair And Neuroprotection In Multiple Sclerosis - „meine Frau Managt Das Ganze Leben Zu Hause - Die Elektrolyte - Das Politische System Der Volksrepublik China - Adjustment Of Schizophrenics In The Community - Rundfunkpolitik Zwischen Sollen Wollen Und Knnen - Menschenkenntnis Hrungskrfte - Ebene Grundwasserstrmungen Mit Freier Oberflche - Chemical Elements In The Environment - Die Politische Deutungskultur Im Spiegel Des „historikerstreits - Konfliktbearbeitung Durch Internationale Organisationen - Die Rechtsabteilung - Bildtafeln Die Genetische Beratung - Chirurgie Anorektaler Krankheiten - Micromounts - Virtuelle Gruppen - Grundlagen Des Dokumenten-managements - Proceedings Of The Xv Symposium Neuroradiologicum - Fachwerk Und Rahmenwerk - Genitale Infektionen - Die Digitale Kluft - Adaptability - Interventionsforschung Band 1 - Basement Correlation Across The North Atlantic - Problemfall Deutsche Einheit - Offensive Marktpositionierung - Dialogische Introspektion - Virology And Immunology In Multiple Sclerosis Rationale For Therapy - Flchentransistoren - Umweltrisiko Und Raumentwicklung - Human-computer Interaction - Numerik Symmetrischer Matrizen - Prospects And Risks Beyond Eu Enlargement - Bildungsbericht Deutschland - Die Kaufmnnische Erfolgs-rechnung Gewinn- Und Verlust-rechnung - Enterprise Wikis - Soziale Identitten Jugendlicher - Collaborative Model For Promoting Competence And Success For Students With Asd - Bildungskontexte - Pdiatrie - Metallurgie Der Ferrolegierungen - –konomie Und Mathematik - Die Kinematographische Kamera - Molecular Genetics Biochemistry And Clinical Aspects Of Inherited Disorders Of Purine And Pyrimidine Metabolism - Gabler Lexikon Marketing - Afrika Jahrbuch 2001 - Grundlagen Der œbertragung Elektrischer Energie - Microsoft Publisher Einsteigen Leichtgemacht - A Practical Guide To Medicine And The Law - Hilfsbuch Apotheker Zum Potenzieren Und Taxieren Homopathischer Und Biochemischer Arzneimittel - Corporate Religion - Lob Des Nfecks - Prmierung Des Friedens - Tragwerke Hochbauten - Elektrische Raumheizung - Software-praktikum - Berhrungen Und Schule - Deutungsmuster Von Lehrkrften - Distributive Justice And Inequality - Controller-anforderungsprofile - Fremdenfeindliche Vorurteile In Den Staaten Der Eu - Frauen Arbeit Und Individualisierung - Atlas Normaler Rntgenbilder Des Schdels Atlas Of Normal Radiographs Of The Skull Atlas De Radiographies Normales Du Cr¢ne Atlas De Radiografias Normales Del Cr¡neo - Wieviel Demokratie Vertrgt Europa Wieviel Europa Vertrgt Die Demokratie - Europischer Journalismus - Die Strafzumessung - Die Technik Der Individualpsychologie - –ffentlich-private Partnerschaften - Die Geschlechtliche Aufklrung Im Erziehungswerke - Entstehung Und Entwicklung Des Rechtsextremismus In Der Bundesrepublik - Telekommunikationsanwendungen Kleine Und Mittlere Unternehmen - Tectonofractography - Die Klinische Rntgendiagnostik Der Inneren Erkrankungen - Modern Food Analysis - Moderner Wahlkampf - Perspektiven Der Medienkritik - Forststhetik - Inference For Diffusion Processes - Visualitt Form Und Mythos In Peter Handkes Prosa - Die Geschichte Einer Jugend - Erythropoietin - Computation Of Biomolecular Structures - Lehrbuch Der Hygiene - Handbuch Des Revolverdrehers - Eigentlich Klar Oder - Aachener Bausachverstndigentage 2002 - Frontiers In Social Dilemmas Research - Tropical Forestry Handbook - The Fallopian Tube - Der Demokratische Verfassungsstaat - Grundzge Der Elektrotechnik - Endoskopie Postoperativer Syndrome - Pharmakopsychologie Und Psychopathologie - Der Leistenschmerz Des Sportlers - Palozoologie - Euro-bankmarketing - Der Kaspar-hauser-effekt - Handbuch Der Schweiytechnik - Die Vorbereitung Des Hochofenmllers - Intraoperative Ultrasound Imaging In Neurosurgery - Cim-handbuch - Finsler Geometry - Resistenz Von Kulturpflanzen Gegen Tierische Schaderreger - Die Krankheiten Des Herzens Und Der Gefsse - Familiendiagnostik - Gefychirurgie - Tissue Characterization In Mr Imaging - Was Top-verkufer Auszeichnet - Immunglobuline In Der Klinischen Neurologie - Mediendiskursanalyse - Chirurgie Der Milz - Handbuch Medienproduktion - Differentialgleichungen Mit Mathematica - Handbuch Zur Frauenbildung - Mechanical Behavior Of Materials Under Dynamic Loads - Texte Und Diskurse - Handbuch Kulturpublikum - Soziologie Im Wandel - Grundlagen Der Steuerungstechnik - Verkaufserfolge Steuern Und Optimieren - Wahrscheinlichkeitsrechnung Und Induktive Statistik - Materialien Zur Soziologie Des Alltags - Die Ampullenfabrikation - Eclipse Phenomena In Astronomy - Gabler Lexikon Corporate Finance - Reliability Data Collection And Use In Risk And Availability Assessment - Das Wesen Des Lichts - Tmlr Management Of Coronary Artery Diseases - Das Politische System Polens - Gynkologie Und Geburtshilfe 1990 - Der Tierarzt Im Hause - Umweltforschung Und –ffentlichkeit - Kunst Und Religion Der Mayavlker - Fuzzy Methoden In Der Wirtschaftsmathematik - Grundlagen Der Bruchmechanik - Beobachtungen Der Moderne - Handlung Und Kompetenz - Die Berechnung Rotierender Scheiben Und Ringe Nach Einem Neuen Verfahren - Die Graphische Behandlung Der Mechanischen Wrmetheorie - Die Dynamik Der Selbststeuerung - Metallfachkunde 1 - X-ray And Neutron Diffraction In Nonideal Crystals - Middleware - Grundriss Der Allgemeinen Chirurgie - Elektrische Meygerte Und Meyeinrichtungen - Kreativitt Im Cyberspace - Jugendliche + Erwachsene 85 Generationen Im Vergleich - Nitrates And Nitrate Tolerance In Angina Pectoris - Optionsscheine Optionen Und Futures - Complex Systems Design And Management - Die Kurzmeldung - Schul- Und Unterrichtsreform Durch Ergebnisorientierte Steuerung - Konkurrierende Generationen Auf Dem Arbeitsmarkt - Berechnung Von Gleichstrom-kraftbertragungen - Wahlkampf Im Web - Die Polizei Des Bundes In Der Rechtsstaatlichen Pluralistischen Demokratie - Die Seminarien Volksschullehrer - Prandtl - Hrer Durch Die Strmungslehre - Gesellschaft In Literarischen Texten - Jugendlicher Rechtsextremismus Und Gewerkschaften - The Global Race For Foreign Direct Investment - Praxishandbuch Rockmusik In Der Jugendarbeit - Politik Und Rhetorik - Social Entrepreneurship And Social Business - Stdtische Armutsquartiere - Kriminelle Lebenswelten - Der Konstitutionstypus - Supercomputing - Finite Element Analysis For Heat Transfer - Medienkompetenz - Sakulrisierung Und Resakralisierung In Westlichen Gesellschaften - Fokus Kunde - Regieren In Koalitionen - Die Erkennung Der Feld- Wiesen- Und Weide-ungrser Unter Bercksichtigung Ihrer Bltenstnde - Frankreichs Auyenpolitik Von De Gaulle Bis Mitterrand - Der Weisstannenkrebs - Das Forschungsprojekt - Vom Wert Der Natur - Elektrotechnikelektronik Maschinenbauer - ‚bildung‘ Jenseits Pdagogischer Theoriebildung - Manual Der Osteosynthese - Recurrent Mood Disorders - Die Subventionen Der Weltschiffahrt Und Ihre Sozialkonomischen Wirkungen - Psychologie Der Lebensalter - Plant Cell And Tissue Culture - Fit Den Generationswechsel Im Unternehmen - Free Radicals And The Liver - Boom-branchen 50plus - Der Regelvorgang Bei Kraftmaschinen Auf Grund Von Versuchen An Exzenterreglern - Professionalitt Und Alltag In Der Erziehungsberatung - Insolvenzrecht - Der Weg In Die Neteconomy - Eier Und Eikonserven - Principles Of Genetic Toxicology - Die Hohe Schule Des Total Quality Management - Stadt Als Lokaler Lebenszusammenhang - Butter · Kse Milchprparate Und Nebenprodukte - Brain Anatomy And Magnetic Resonance Imaging - Handbuch Regierungsforschung - Brennstoffe · Kraftstoffe Schmierstoffe - Uncertainty And Forecasting Of Water Quality - Den Kundennutzen Managen - Der Einfluss Tiefer Atmung Auf Den Herzrhythmus Sinusrhythmus Und Seine Klinische Verwendung - Die Mercerisierungsverfahren - Frontiers In Computer Graphics - Visual Basic Essentials - Management Skills - Ultraschall In Der Chirurgie - Control And Automation In Anaesthesia - Advances In Human Genetics 11 - Mdchenfreundschaften In Der Adoleszenz - Die Anwendung Der Nomographie In Der Mathematik - Simulation By Bondgraphs - Die Emailfabrikation Ein Lehr- Und Handbuch Die Emailindustrie - Deutsch „rztinnen Und „rzte - Die Gaserzeuger - Die Anatomie Des Menschen - Deutsche Politikwissenschaftler In Der Emigration - Differentialgeometrie Und Homogene Rume - Die Pathologische Anatomie Der Familie - Konflikte Im Betriebsrat Als Lernanlass - Krankenpflege-lehrbuch - Laue Atlas - Die Wirtschaftliche Entwicklung Der Beiden Staaten In Deutschland - Nanorobotics - Air Pollution Modeling And Its Application Vii - Software-engineering - Zwischen Rausch Und Realitt - Regiomontanus - Direkte Demokratie - Cimmit 2000 Jahrbuch Immobilien - Die Blei-zinkerzlagersttte Von Bleiberg-kreuth In Krnten - „elemente Der Informatik - Der Beton - Zulssige Fremdstoffe Und Zusatzstoffe Lebensmittel In Der Bundesrepublik Deutschland - Der Krper Im Biographischen Kontext - Seh- Und Hreinbuyen Lterer Menschen - Programmieren In Lisp - Recent Contributions To Fluid Mechanics - The Fractal Company - Planung Und Optimierung Von Rechnernetzen - Einhrung In Die Wahrscheinlichkeitsrechnung Und Statistik Ingenieure - Grundlagen Der Prozesstheorie - Politische Theorie - Einhrung In Die Mathematik Studenten Der Wirtschaftswissenschaften - Autologous Resurfacing And Fracture Dowelling - Frieden Oder Sicherheit - Germinal Centers In Immune Responses - Die Neue Rechte In Deutschland - Ohne C Zu C++ - Mineralle Und Verwandte Produkte - Die Arbeiterverhltnisse In Der Forstwirthschaft Des Staates - Syntaktische Grenzen - Die Gesellschaftliche Verankerung Politischer Parteien - Die Deutsche Gesellschaft In Vergleichender Perspektive - Rechnergesttzte Betriebsorganisation - Sprechwissenschaft And Psycholinguistik 2 - Kriege In Der Weltgesellschaft - Die Technik Der Eingriffe Am Gallensystem - Centrifugal Pumps - Flame Hardening - Erziehung Bildung Und Geschlecht - Microvascular Corrosion Casting In Scanning Electron Microscopy - How Firms Can Strategically Influence Open Source Communities - Friedrich Wieser Als Soziologe - Thermodynamic Data On Oxides And Silicates - Volkswirtschaftslehre Bankkaufleute - Arbeitsbuch Mathematik Ingenieure Band Ii - Umweltvertrglichkeit In Der Abfallwirtschaft - Der Sugling - –ffentlicher Personennahverkehr - Grundzge Der Beleuchtungstechnik - Reiseverkehrsgeographie - Rumlicher Strukturwandel Im Zeitalter Des Internets - Die Groyen Regierungserklrungen Der Deutschen Bundeskanzler Von Adenauer Bis Schrder - Strahlenklima Der Erde - Gesammelte Abhandlungen Zur Funktionellen Anatomie Des Bewegungsapparates - Der Liquor - Profis Im Finanzvertrieb - Die Quarzlampe - „einigkeit Und Recht Und Freiheit - Bundestagswahl 2002 - Immunopharmacology - Fernsehen - A Solution To The Riddle Dyslexia - Mediengesellschaft - Motivation And Action - Die Analyse Und Verflschung Der Nahrungsmittel - Die Grundlagen Der Relativittstheorie - Green Business Process Management - Organisation 2000 - Synoptische Meteorologie - Rohrleitungen In Neuzeitlichen Wrmekraftanlagen - Handbuch Der Frserei - Bolustokolyse In Theorie Und Praxis - Formulas Ingredients And Production Of Cosmetics - Adsorption And The Gibbs Surface Excess - Fem Bei Elektrischen Antrieben 1 - Politische Bildung In Deutschland - Bildung Unter Bedingungen Kultureller Pluralitt - Stenosis Of The Cervical Spine - Spezialgebiete Der Gasdynamik - Erziehen Als Profession - Beobachtung In Der Schule Beobachten Lernen - Allgemeines Versicherungsvertragsrecht - Handbuch Des Wissenschaftstransfers - Principles Of Lasers - Zeitgenssische Amerikanische Soziologie - Erinnerungsarbeit - Baukonstruktionslehre - The Evolution Of The Use Of Mathematics In Cancer Research - Erddrucktheorien - Klinische Antiseptik - Physik Formelsammlung - Die Separation Von Feuerungsrckstnden Und Ihre Wirtschaftlichkeit - Demokratie Und Streitkrfte - Finanzen Defizit Und Notenpresse 19141922 - Phase Separation In Cuprate Superconductors - Soziologielehre In Deutschland - Grundkurs Wirtschaftsmathematik - Einhrung In Die Netzwerkanalyse Mit Spice - Mineralogisches Taschenbuch Der Wiener Mineralogischen Gesellschaft - Arbeitsorganisation Und Neue Technologien - Chemische Unterrichtsversuche - Costs And Benefits In Health Care And Prevention - Parlamente Und Systemtransformation Im Postsozialistischen Europa - Leitfaden Auyenwirtschaft - Pro Aspnet Mvc 4 - Die Banken In Ihrer Gryten Krise - Wie Geht Es Weiter - Tron Project 1990 - Die Kunst Keine Perfekte Hrungskraft Zu Sein - Grundinformation Recht - Lndliche Netzwerke - Einheitliche Bezeichnung Der Lokomotiven Tender Und Triebwagen - Die Wiehler Urgroymutter Und Ihre Verwandtschaft - Die Macht Des Kunden Und Wie Sie Ihn Trotzdem Kriegen - Die Deutsche Finanzwirrnis - Umwelt Und –konomie - Die Hochdrucklokalansthesie - Die Eiweisskrper Und Die Theorie Der Kolloidalen Erscheinungen - Geometry Of Quantum Theory - Stress And Tension Control 3 - Der Kiefernspanner Bupalus Piniarius L - Analysis 1 - Grundzge Der Botanik Pharmazeuten - Nondestructive Characterization Of Materials - Personalinformationssystem - Transforming Ethnopolitical Conflict - Integration Durch Verfassung - Gewaltenteilung Und Parteien Im Wandel - Hchstdruckdampf - Mitarbeitermotivation Im Outsourcing Unter Besonderer Bercksichtigung Des Facility Managements - Einhrung In Die Allgemeine Und Spezielle Vererbungspathologie Des Menschen - Internationalisation And Mode Switching - Missvergngen - Absolute Thermische Daten Und Gleichgewichtskonstante - Wirtschaftspopulismus - Prfungstrainer Physik - Jg=tafel Luft Und Verbrennungsgase - Regional Acidification Models - Datenbertragung Nachrichtentechnik In Datenfernverarbeitungssystemen - Noninvasive Methods For The Quantification Of Skin Functions - Surface And Colloid Science - Bildungspolitik In Deutschland 19451990 - Hoai-kommentar - Ultraschall-diagnostik 89 - Psychoanalytisches Wissen - Generation Transformation - Integrationspdagogik Und Geschlecht - Moralische Individualitt - Der Medien-prozey - Unternehmensverkauf - Therapy Of Malignant Brain Tumors - Weiblich Ledig Kinderlos Und Alt - Mehr Umsatz Mit Kaltakquise Und Direktbesuch - Staatsbrgerschaft Im Einwanderungsland Deutschland - Prozeyinformatik - Spices Condiments And Seasonings - Erzhlen In Der Therapie - Ergebnisse Der Lepraforschung Seit 1930 - Die „nderungen Der Sozialen Versicherungsgesetze Seit Ausbruch Des Krieges - Mey- Steuerungs- Regelungstechnik - Erkundung Von Verkehrswegen In Neulndern - Demokratie Und Internet - Das Interview In Der Psychologie - Java Ist Eine Sprache - Die Inszenierung Des Politischen - Atlas Der Experimentellen Kaninchensyphilis - Versuch Einer Ontologie Der Persnlichkeit - Management Reporting - Medical Parasitology - Vergleichende Politikwissenschaftliche Methoden - Physikalischen Und Chemischen Methoden Der Quantitativen Bestimmung Organischer Verbindungen - Herausforderung Risikomanagement - Developments In Laser Techniques And Applications To Fluid Mechanics - Hydraulic Machinery And Cavitation - Philosophia Perennis - Soziologie Und Sozialgeschichte - Elektromagnete - Entropie Ingenieure - Cohomology Theories For Compact Abelian Groups - Deutsche Migrationspolitik Im Neuen Europa - Performance Und Skalierung Von Sap Erp Systemen In Virtualisierten Umgebungen - Vorsprung Durch Sympathie - Atlas Der Morphologischen Plazentadiagnostik - Preismanagement Im Privatkundengeschft Von Banken - A Brief History Of Computing - Jugendbewegung - Online Searching On Stn - Computational Mechanics 86 - Die Materialprfung Der Isolierstoffe Der Elektrotechnik - Differentialdiagnose - Research Techniques For High Pressure And High Temperature - Internal Fixation Of Small Fractures - Metallniederschlge Und Metallfrbungen - Basic Notes In Psychiatry - Quantum Chemistry Of Organic Compounds - Erfolgreiche Strategien Die Kundenbindung - Verkaufsgesprche Und Verkaufstrainings - Visual Basic Net Mit Methode - Elementare Moderne Physik - Neues Europa Alte Eu - Einhrung In Die Klassische Elektrodynamik - Experiential Education And Adolescents Personal And Spiritual Development - Soziale Arbeit Als Transdiziplinre Wissenschaft - Die Kontrolle Des Dampfkesselbetriebes In Bezug Auf Wrmeerzeugung Und Wrmeverwendung - Estriche Und Bodenbelge - Max Webers Grundbegriffe - Nahost Jahrbuch 1989 - Grundlagen Der Lebensmittelmikrobiologie - Linguistic Identity Matching - Urological Emergencies In Clinical Practice - Silizium-halbleitertechnologie - Die Methoden Der Rahmenstatik - Aktuelle Neuropdiatrie 1990 - Grundriy Der Entwicklungsgeschichte Des Menschen - Opferschutz Im Strafverfahren - Hilft Die Entwicklungshilfe Langfristig - Dormagener Qualittskatalog Der Jugendhilfe - Schwarzes Geld And Weiye Weste - Bild Und Wirklichkeit - Zukunftsbranche Biotechnologie - Epithelial Secretion Of Water And Electrolytes - Hauptbegriffe Qualitative Sozialforschung - Progressive Muskeldystrophie Myotonie · Myasthenie - Grundkurs Soziologie - Die Fragmentierung Des Medienpublikums - Pro Sql Server 2012 Administration - –ffentlichkeit Und Gegenffentlichkeit Im Internet - Sieve Elements - Eine Neue Bildungsfinanzierung - Jugend Religion Und Modernisierung - Elektrochirurgie Am Auge - Acid Deposition Environmental Economic And Policy Issues - Variable Stars - Chancengleichheit Auf Japanisch - Zwischen Pragmatischer Und Moralischer Ordnung - Praktisches Baustellen-controlling - Evolving Strategies And Tactics In Membrane Research - Verstehen Im Unterricht - Chemische Laboratoriumstechnik - Tuberkulose Im Kindesalter - Molecular Geometry Of Body Pattern In Birds - Das Objekt-paradigma In Der Informatik - Elektronenmikroskopische Untersuchungs- Und Prparationsmethoden - Handbuch Der Kombinationsbewegungen - Frankreich-jahrbuch 1989 - Die Lernende Bankorganisation - Continuum Theory Of Inhomogeneities In Simple Bodies - Neuro-vascular Neuro-ophthalmology - Vernetzte Sicherheit - Measurements In Pediatric Radiology - Theorie Und Berechnung Von Tragwerken - Die Krankheiten Der Endokrinen Drsen - Analytische Und Projektive Geometrie Die Computer-graphik - Die Wasserheizung - Elektronenmikroskopie In Der Festkrperphysik - Information Und Gestaltung - Die Syphilis Des Zentralnervensystems - Kreative Industrien - Die Mannich-reaktion - A New Reference Grammar Of Modern Spanish - Stromrichter-netzrckwirkungen Und Ihre Beherrschung - Mnnlichkeit Und Soziale Ordnung - Leitfaden Der Werkzeugmaschinenkunde - Fast Numerical Methods For Mixed-integer Nonlinear Model-predictive Control - Grundkurs Funktionentheorie - Abschied Von Der D-mark - Das Mediensystem Der Bundesrepublik Deutschland - Lebensthema Sexualitt - Neue Unterhaltsame Astronomie - Bericht Ber Die Zweite Tagung Ber Psychopathensorge - Experteninterviews - Felix Hausdorff - Gesammelte Werke Band Ia - Themen Der Rechten Themen Der Mitte - Kurzgefasstes Lehrbuch Der Gerichtlichen Psychiatrie Mediziner Und Juristen - Anxiety And Depression In Children And Adolescents - Online-medien Als Quellen Politischer Information - Harderian Glands - Ganzheitliches Direktmarketing - Wireless-netzwerke Den Nahbereich - Die Herz- Und Gefss-krankheiten - Film Und Krieg - Vernetztes Verkaufen - Akademiker-arbeitslosigkeit - Verkaufen Mit Offenen Ohren - Handbuch Fahrerassistenzsysteme - Gicht Und Rheumatismus - Traumatologie Der Peripheren Nerven - Das Fenster Zum Raum - Frhwarnindikatoren Und Krisenfrhaufklrung - Climate Change And Rice - Scientific Computing - Generationen Eines Jahrhunderts - Zusammenhalt Durch Vielfalt - Die Politik Zur Deutschen Einheit - Immobilien Investment - Burnout Aus Ressourcenorientierter Sicht Im Geschlechtervergleich - The Influence Of Antibiotics On The Host-parasite Relationship Iii - Hrung Neu Verorten - Die Kche Im Wohnerlebnis Der Deutschen - Die Psychoanalyse Und Ihre Kinder - Institutionelle Arrangements In Der Umweltpolitik - Bildungsentscheidungen Als Sozialer Prozess - Doppelte Buchhrung - Die Wirksamkeit Der Entwicklungshilfe - Die Reichsfinanzgesetzgebung Von 1913 - Netzwerk- Und Datensicherheit - Die Elektrischen Wechselstrme - Klinische Infektionslehre - Reliability Evaluation Of Engineering Systems - Exkursionsbuch Zum Bestimmen Der Vgel In Freier Natur - Regierungssystem Und Regierungslehre - Bildungsautonomie Zwischen Regulierung Und Eigenverantwortung - Bildgebende Diagnostik Bei Lebererkrankungen - Aus Dem Auen-mittelwalde - Hepatobiliary Diseases - Wlzlager - Aufwachsen Und Lernen In Der Sozialen Stadt - Der Kreislaufkollaps - Soziologie Im Konzert Der Wissenschaften - Festverzinsliche Wertpapiere - Hochleistungskessel - Demokratie In Europa Und Europische Demokratien - Handbuch Geotechnik - Paul Ehrlich - Erdung Nullung Und Schutzschaltung - Systemprogrammierung In Unix Linux - Grenzenlose Konstruktivitt - An Den Grenzen Der Mehrheitsdemokratie - Internetstrategien Von Lokal- Und Regionalzeitungen - Symposium On High-energy Electrons - Die Private Vermgensanlage Des Unternehmers - Die Manen Oder Von Den Urformen Des Totenglaubens - Digital Memory And Storage - Religion Ohne Institution - Die Sozialen Arbeitsverhltnisse Im Wandel Der Zeit - 50 Jahre Empirische Wahlforschung In Deutschland - Angeborene Herzfehler - Geowissenschaften Und Umwelt - Computerstile - Wertschpfungsmanagement Im Einkauf - „arbeiterklasse Oder Arbeitnehmer - Mri Of The Body - Grundlagen Der Informatik Ingenieure - Gram-negative Bacterial Infections And Mode Of Endotoxin Actions - Israel In Nahost Deutschland In Europa Nahtstellen - Handbuch Des Maschinenwesens Beim Baubetrieb - Leistung Aus Kultur - Fortschritte Der Teerfarbenfabrikation Und Verwandter Industriezweige - The Role Of Community-mindedness In The Self-regulation Of Drug Cultures - Transductions And Context-free Languages - Die Dreielektrodenrhre Und Ihre Anwendung - Generationen Und Sozialer Wandel - Wissenschaftliche Und Alternative Medizin - Leseglck - Gestaltung Und Management Von It-vertrgen - Risiko Und Gesellschaft - Politische Identitt Und Nationale Gedenktage - Umweltrecht - Marken In Der Politik - Wrmebertragung Im Gegenstrom Gleichstrom Und Kreuzstrom - Transformationsprobleme In Ostdeutschland - Distributed Autonomous Robotic Systems 3 - Intellectual Capital Und Kommunikation - Praktische Doppler-sonographie - Perception Interaction And Language - Beginning Database Design - Demokratie Eine Kultur Des Westens - Gestaltung Regionaler Politik - Logistikprozesse Mit Sap R3 - Clinical Facial Analysis - Handbuch Zur Visuellen Diagnose Von Ernhrungsstrungen Bei Kulturpflanzen - Genozid Und Moderne - Der Entropiesatz Oder Der Zweite Hauptsatz Der Mechanischen Wrmetheorie - Visuelle Kommunikationsforschung - Gesundheitssorge Soƶiale Und Private Versicherung - Interventionen Am Herzen - Die Ventilatoren - Stimulated Cerebral Blood Flow - Leitfaden Den Waldbau - Pro Spring Mvc With Web Flow - Erbbiologie Und Erbpathologie Nervser Und Psychischer Ƶustnde Und Funktionen - Einfluss Von Steuern Auf Unternehmerische Entscheidungen - Geschlechterdifferenzierungen Im Horizont Der Gleichheit - Ergebnisse Und Probleme Der Modernen Anorganischen Chemie - Umwelt-bioverfahrenstechnik - Grundlagen Der Elektrischen Energieversorgung - Grundwissen Mathematik Ingenieure - Unartikulierte Krper - Bevlkerungslehre Und Bevlkerungspolitik Vor 1933 - Der Buchmarkt Als Kommunikationsraum - Chemie Der Menschlichen Nahrungs- Und Genussmittel - Die –ffnung Des Staates - Anlagenmanagement - Die Vorteilhaftigkeit Relativer Anreizschemata Unter Bercksichtigung Der Kollusionsgefahr - Polizeipolitik In Europa - Betriebswirtschaftliches Kontaktstudium - Allgemeine Und Spezielle Physiologie Des Menschenwachstums - œbergnge - Personalpolitische Handlungsalternativen Mit Lteren Arbeitnehmern In Unternehmen Vor Dem Hintergrund Der Demographischen Entwicklung In Deutschland - Parteien In Der Brgergesellschaft - Ingenieurmechanik - Betriebswirtschaftslehre Und Betriebliche Praxis - Die Mikroskopischen Boden-pilze - Smiths Urologie - Wahlfreiheit In Der Fernsehnutzung - Handbuch Digitaler Schnittstellen - Das Radialbohren - Wettlauf Um Die Alten - Technologietechnik - Epidemiology Of Peripheral Vascular Disease - Jugend Politik Und Politische Bildung - Lernendes Unternehmen - Raum Zeit Medialitt - Die Welt Der Vektoren - Lineare Algebra Mit Mathematica Und Maple - Broken Markets - Developmental Neuropathology - Die Ohnmacht Bei Der Geburt Vom Gerichtsrztlichen Standpunkt - Morenos Therapeutische Philosophie - Beispiele Zur Bemessung Von Betontragwerken Nach Ec 2 - Konsumentenheterogenitt Und Struktur Des Auyenhandels - Jugend Krper Und Geschlecht - Erfolgreiches It-management In Der Praxis - Handbuch Der Normalen Und Pathologischen Physiologie - Dokumentationsverfahren In Der Herzchirurgie - Practical Html5 Projects - Gemeinschaftsverpflegung - Der Deutsche Olympische Sportbund In Der Zivilgesellschaft - Sprache Und Kommunikation Im Alter - Keine Angst Vor Dem Finanzamt - Lehrbuch Der Kinderheilkunde - Einhrung In Die Vererbungswissenschaft - Elektrotechnische Winke Architekten Und Hausbesitzer - Einheit Der Wissenschaft - Die Konomische Analyse Von Kommunikationsbeziehungen In Organisationen - Der Rastlose Mensch - Grundlegung Einer Forstlichen Betriebslehre - Perspektive Und Axonometrie - Investigative Urology 3 - Politik Und Technik - Der Vestibulre Nystagmus Und Seine Bedeutung Die Neurologische Und Psychiatrische Diagnostik - Abdominale Ultraschalldiagnostik - New Trends In Computer Graphics - Joseph Alois Schumpeter - Bau Und Berechnung Der Dampfturbinen - Corporate Governance Und Managementberatung - Zwischen Zsur Und Zensur - Major Fractures Of The Pilon The Talus And The Calcaneus - Coil Coating - Step Standard For The Exchange Of Product Model Data - Der Geologische Aufbau –sterreichs - Was Will Die Jngere Mit Der Lteren Generation - Wissenschaft In Der Wissensgesellschaft - Qualitative Perspektiven Des Medienwandels - Die Lehre Von Den Kettenbrchen - Zukunft Der Demokratie In Deutschland - Die Versorgung Des Brandverletzten Im Katastrophenfall Band 2 - Bauforschung Und Ihr Beitrag Zum Entwurf - Wahl-kampf Um Europa - Grundzge Einer Physiologie Und Klinik Der Psychophysischen Persnlichkeit - Organisation Strukturwandel Und Arbeitsmarktmobilitt - Soziale Arbeit Und Demokratie - Biochemische Grundlagen Der Disposition Karzinom - A New Institutional Economics Perspective On Industry Self-regulation - Electronic Fashion - Jahrbuch Der Schiffbautechnischen Gesellschaft - Die Nachbehandlung Nach Chirurgischen Eingriffen - Selbst- Und Ko-regulierung Im Mediamatiksektor - Die Verhaltenstherapeutische Behandlung Des Stotterns - Physik In œbungsaufgaben - A Guide To Drugs In Current Use - Kostenberechnung Im Tiefbau - Anaerobtechnik - Elemente Der Neurologie - Arbeitsvermgen - Integrated Usage Mining - Das Kriegsgeschehen 2002 - Handlungsproblem Computer - Der Sektionskurs Kurze Anleitung Zur Pathologisch-anatomischen Untersuchung Menschlicher Leichen - Kardiales Risiko Beim Sport - Hmatologie Und Onkologie - Mathematische Bildung Und Neue Technologien - Das Single - Management Der Fand E-strategie - Das Ende Der Hierarchien - Praxisorientiertes Online-marketing - Self-leadership Und Hrung - Mechanik Auf Dem Bildschirm Mit Dem C64 - Leitfaden Zur Pflege Der Wchnerinnen Und Neugeborenen - Die Vitamine - Metallurgy Of Welding - Die Fabrikation Der Feuerfesten Steine - Jahrbuch Medienpdagogik 1 - Verteilte Systeme Unter Unix - Markensterben - Fehler Und Fehlerkultur Im Krankenhaus - Emil Fischer - Finite Element Programs For Structural Vibrations - Bauphysikalische Temperaturberechnungen In Fortran - Wie Whlen Neubrger - Hunger Und Unterernhrung - Neurolinguistik - Jahresabschluyprfung Der Kapitalgesellschaften - Die Homerische Tierwelt - Der Nachrichtenwert Im Situativen Kontext - Die Programmatische Entwicklung Der Pds - Ist Die Brse Reformbedrftig - Instinkt Und Erfahrung - Zehn Blatt Der Schriftproben 17 - Das Unternehmertum Und Die Ffentlichen Zustnde In Deutschland - Dynamics Of Science-based Innovation - Extrema Of Smooth Functions - Beobachtung Verstehen Verstehen Beobachten - Einhrung In Die Chemie - Geschichte Des Deutsch-franzsischen Krieges 1870 Und 1871 - [email protected] - Umweltbetriebsprfung Und –ko-auditing - Grundkurs Microsoft Dynamics Ax - Jugend Im Generationen-kontext - œbergang Zur Erwerbsttigkeit - Praxishandbuch Corporate Magazines - Vorlesungen Ber Numerische Mathematik - Ein Gang Durch Biochemische Forschungsarbeiten - Rechnen Bankkaufleute - Holz- Und Baumpilze - Komplexe Zahlen Und Zeiger In Der Wechselstromlehre - Cc++ Werkzeugkasten - Neurologie Des Vegetativen Systems - Lehrbuch Der Elektrochemie - Einhrung In Die Hhere Mathematik - Windkraftanlagen Im Netzbetrieb - Net Kids - Optical Signal Processing - Surgery Of Vertebrobasilar Aneurysms - –kologische Kompetenz - Augenerkrankungen Im Kindesalter - Akquisition Auftrag Profit - Wiederverwendung Qualitativer Daten - Der Deutsche Frauenrat - Migration Und Geschlechterverhltnisse - Flows Of Faith - Leichtbau-konstruktion - Werkstckspanner - Aufstze Zur Deutschen Revolution - Schauderhaft Banales - Handbuch Wissenschaftskommunikation - Edelguss - Frankreich-jahrbuch 2001 - Lipide Und Lipoproteide Im Blutplasma - Qualittsmanagement Und Zertifizierung - Love As Pedagogy - Lineare Algebra Und Analytische Geometrie - Human Resource Management Im Umbruch - Das Mensch-tier-verhltnis - Die Variabilitt Niederer Organismen - Leitfaden Der Histologie Des Menschen - Dutch Elm Disease Research - Die Chemie Der Bau- Und Betriebsstoffe Des Dampfkesselwesens - Frauen In Der Kleinbuerlichen Landwirtschaft - Attention Deficit Hyperactivity Disorder Handbook - Numerical Algorithms With Fortran - Lehrbuch Der Inneren Medizin Schwestern - Sexueller Missbrauch Mediendarstellung Und Medienwirkung - Wohlfahrtsstaatliche Politik In Jungen Demokratien - Organisationsentwicklung Und Organisationales Lernen Von Schulen - Biomedical Ethics And The Law - Die Vermessung Kultureller Unterschiede - Topics In Nonlinear Physics - Lernort Universitt - First Steps In Mathematica - Scientific Literacy - Klinische Endokrinologie - Die Edelsthle - Wirtschaftsstatistik Im Bachelor - Berichterstattung Zur Sozio-konomischen Entwicklung In Deutschland - Teilhabe Im Umbruch - Grundzge Der Geschichte Und Wirtschaft Der Kniglichen Oberfrsterei Eberswalde - Konstruktionsleitfaden Fertigungstechnik - Sprichwrter Und Redensarten Im Interkulturellen Vergleich - Risikomanagement In Projekten - Der Aufbau Der Kupfer-zinklegierungen - Arteriosklerose - Photoreceptor Optics - Chancen Und Risiken Von Rohstoffinvestments - Echtzeitsysteme Und Objektorientierter Entwurf - Pdosexualitt - Haushalt-kltemaschinen Und Kleingewerbliche Khlanlagen - Von Handy Glasfaser Und Internet - Heinrich Von Kleist - Rheumatoid Arthritis - Geschichte Der Herzrhythmusstrungen - Politik Und Wirtschaftswachstum - Hygiene Und Ditetik Der Frau - Edi-knigge - Identittsbasierte Markenhrung Professioneller Sportvereine - Konservative Therapie In Schwangerschaft Geburt Und Wochenbett - Multicellular Animals - Democratic Development - Kommunikation –ffentlichkeit –ffentlichkeitsarbeit - Organisationskommunikation Und Public Relations - Wissenschaftliches Interesse Und Politische Verantwortung Dimensionen Vergleichender Bildungsforschung - Preismanagement - Geschichte Der Erwachsenenbildung In Deutschland - Die Erziehungsanstalt Schnepfenthal 17841934 - I Geologie Markscheidewesen - Cervical Spine Ii - Reaching Algebra Readiness Rar - Spontaneous Abortion - Leben Ohne Arbeit Arbeit Als Los - Politbarometer - Einhrung In Die Programmiersprache Simula - Jahrbuch Verkaufstraining - Betriebsanalysen - Mri Of The Head And Neck - Surgery Of The Skull Base - Molecular Neurobiology Of The Mammalian Brain - Erektile Funktionsstrungen - Leadership In Krisen - Dynamik Der Mechanismen - Metallfachrechnen 5 - Shock Waves @ Marseille Iii - Praxis Der Abwasserreinigung - Interne Revision - Prolegomena Einer Medizinischen Anthropologie - Regional Advantage And Innovation - Programmpolitik Zwischen Markt Und Moral - Visualisierung In Mathematik Technik Und Kunst - Massivbau - Ideologie Nach Ihrem ‚ende‘ - The Silent Countdown - Systeme Und Subjektstrukturen - Magnetospheric Physics - Kriminal≈psychopathologie Und Psychobiologische Verbrecherkunde - Deutsche Waldwirtschaft - Amerikanische Und Deutsche Lhne - Ursprnge Der Zweiten Republik - Betriebs-chemie Maschinenbauer Und Elektrotechniker - Lehrbuch Der Geschichtsphilosophie - Plastics Processing Data Handbook - Perspektiven Verurteilter Wirtschaftsstraftter - Elektrische Kraftbertragung Und Kraftverteilung - The Mammalian Egg Coat - Betriebliches Interessenhandeln - Qualifizieren Eine Global Vernetzte –konomie - Das Sternsystem - Arteriosklerose Und Fibrininkorporation - Das Rot-grne Projekt - Die Europische Union Nach Der Osterweiterung - The Pyloric Sphincteric Cylinder In Health And Disease - Kompendium Internistische Onkologie - Elemente Der Regelungstechnik - Die Entwicklung Ihres Unternehmens - Grundlagen Der Gasdynamik - Analyse Der Fette Und Wachse Sowie Der Erzeugnisse Der Fettindustrie - Fundamental Beta - Anleitung Zum Mischen Von Branntweinen Nach Maay Und Gewicht - Glasschmelzfen - Geschichte Der Homopathie - Mathematische Methoden In Der Hochfrequenztechnik - Imaging Of Brain Metabolism Spine And Cord Interventional Neuroradiology Free Communications - Kabeltechnik - The Physical Chemistry Of Membranes - Handbuch Der Mikrochemischen Methoden - Das Deutsche Beamtengesetz Dbg - Die Zweite Groye Koalition - Systematic Musculoskeletal Examination - Der Anomische Staat - Benign Lesions Of The Esophagus And Cancer - Design And Simulation Of Spectrum Management Methods For Wireless Local Area Networks - Gesetz Ber Die Aufwertung Von Hypotheken Und Anderen Ansprchen Aufwertungsgesetz Vom 16 Juli 1925 Und Durchhrungsverordnung Vom 29 November 1925 - Elastisches Wuchten - Aus Der Werkstatt Der Psychoanalytiker - Der Verkappte Einheitsstaat - Analytische Berechnung Elektrischer Leitungen - Medien Und Die Soziale Konstruktion Von Zeit - Physics Of Solar Variations - Advanced Course On Fairshape - Die Auslndische Familie - Jugendsprache - Small Bowel Radiology - Knotentheorie Einsteiger - Best Services - Die Praktische Nutzanwendung Der Prfung Des Eisens Durch „tzverfahren Und Mit Hilfe Des Mikroskopes - Chronische Virushepatitis Und Ihre Behandlung Mit Interferon Alfa - Hochhuser In Deutschland - Das Einmaleins Der Siedlung - Aufgaben Und Lsungen Die Bilanzbuchhalterprfung - Chirurgie Der Infektionen - Moeller Grundlagen Der Elektrotechnik - –ffentliches Baurecht Praxisnah - Die Klinik Der Coronarerkrankungen - Die Verfestigung Der Metalle Durch Mechanische Beanspruchung - Arbeitsmrkte Und Sozialstrukturen In Europa - Objekte Integrieren Mit Ole2 - C A Bjerknes - Soziologie In Pdagogischen Kontexten - Die Englische Aktien-gesellschaft Nach Neuem Recht - Potassium Argon Dating - Die Soziologen Und Das Recht - Bankgeheimnis Ade - Amtstrger In Der Parteiendemokratie - Die Drahtseile - Operations Research - Frontiers In Materials Modelling And Design - Erzhlen Im Kontext Neuer Lernkulturen - Kommunikationswissenschaft Im œberblick - Mikrosystemtechnik - Therapie Der Angina Pectoris Mit Teopranitol - Effizienz Im Marketing - Controlling Im Gesundheitsbetrieb - Tag Und Woche Monat Und Jahr - Vorlesungen Ber Mathematische Statistik - Kommunikation Und Differenz - Handbuch Des Strayenbaus - H Rietschels Leitfaden Der Heiz- Und Lftungstechnik - Soziale Arbeit In Lndlichen Rumen - Biochemical Engineering For 2001 - Teubner-taschenbuch Der Statistischen Physik - Schizophrenia - Dampfkesselschden Ihre Ursachen Verhtung Und Nutzung Die Weiterentwicklung - Practical Thoracoscopy - Klassische Diesel-einspritzsysteme - Die Lehre Vom Status Thymico-lymphaticus - Surgery Of The Sellar Region And Paranasal Sinuses - Rechnungswesen Brokaufleute - Das Biokybernetische Modell - Wind Turbine Noise - Lehrbuch Der Bergwirtschaft - Nomination Fachsprachlich Und Gemeinsprachlich - Hochbau Ingenieure - Brckendynamik - Malignant Brain Tumours - Dictionary Of Abbreviations In Medical Sciences - Surfactant Replacement Therapy - Die Grundgesetze Der Wrmeleitung Und Ihre Anwendung Auf Plattenfrmige Krper - Schweiyen Und Lten Mit Festkrperlasern - Voices From The Classroom - Blockierte Demokratien In Der Dritten Welt - Taxation Of European Companies At The Time Of Establishment And Restructuring - Web-programmierung - Depressionskonzepte Heute Psychopathologie Oder Pathopsychologie - Elektro-fachkunde 2 - Leitfaden Der Anthropologie - Mngelansprche Nach Vob Und Bgb - Eisenbahn Und Kraftwagen - Brgerliches Recht I - Lebensverlufe In Der Moderne 1 Nichteheliche Lebensgemeinschaften - Revision Surgery In Total Hip Arthroplasty - Die Grundlagen Der Einsteinschen Gravitationstheorie - Qualittsmanagement In Der Assekuranz - Aus Heiteren Jugendtagen - Sustainable Manufacturing - Molecular Basis Of Membrane-associated Diseases - Zwerchfellpathologie Im Rntgenbild - Joint Ventures In Den Gus-staaten - Fundamentals Of Power Electronics - Kosovo - International Conference On High Energy Physics International Union Of Pure And Applied Physics 24 1988 Mnchen - Information Und Wirtschaftlichkeit - Campylobacter Pylori - Qualitative Forschung In Der Sozialpdagogik - Die Kunst Des Clusterns - Qualitt Von Humandienstleistungen - Generalisierte Tendomyopathie Fibromyalgie - Bauen Mit Din-normen - Psychotic Continuum - Signalbertragung - Das Wissen Bankkaufleute - Modern Production Concepts - Karst Hydrology - Hyperurikmie Gicht Und Andere Strungen Des Purinhaushalts - Weiterbildung Zwischen Grundrecht Und Markt - Stdtebauliches Entwerfen - Werke - Ermdungsrisse - Das Kleine Nein Im Groyen Ja - Grundlagen Und Methoden Aufsuchender Jugendarbeit - Vom Bankberater Zum Beziehungsmanager - Das Entwerfen Von Graphischen Rechentafeln - Digitale Demokratie - Handbuch Organisationstypen - Production Planning In Automated Manufacturing - Viewegs Geschichte Der Technik - Mit Benchmarking An Die Spitze - Berichterstattung Zur Soziokonomischen Entwicklung In Deutschland - Optische Sensorik - Size Exclusion Chromatography - Graphische Kinematik Und Kinetostatik - Sinnstiftung Als Beruf - Heart And Brain Brain And Heart - Zur Theorie Des Absatzes - Manual Der Fetalen Medizin - Kurzes Handbuch Der Ophthalmologie - Korruption - Aleksandr Porfirevich Borodin - Multiple Criteria Decision Support In Engineering Design - Looking To The Future - Ao-instrumente Und -implantate - Der Sprechende Zuschauer - Die Forstliche Statik - Brgermeister Curtius - High-risk Breast Cancer - Soziales Im Netz - Quantitative Social Research In Germany And Japan - Chronic Pancreatitis - Programmieren In C - 3 Kongrey Der Deutschen Gesellschaft Intraokularlinsen Implantation - Therapie Mit Gallopamil - Experimentelle Psychologie In Demonstrationen - Kostenermittlung In Der Altbaumodernisierung - Physics At Kaon - Ethische Investments - Aktuelle Hrungstheorien Und -konzepte - Der Einfache Schleimhautkatarrh Der Oberen Luftwege Und Seine Behandlung - Betriebs- Und Selbstkostenprobleme Der Wollindustrie - Spitzenkandidaten Und Wahlerfolg - Festschrift The Institute Of Nuclear Medicine - Electron Microscopy Of Plant Pathogens - Personalentwicklung Im Wandel - Einhrung In Die Komplexe Behandlung Von Wechselstromaufgaben - Querschlger - Lehrbuch Der Konstruktiven Geometrie - C Als Erste Programmiersprache Iso-standard - Anatomie Des Menschen Ein Lehrbuch Studierende Und „rƶte - Soziale Hilfe Ein Teilsystem Der Gesellschaft - Die Berechnung Von Steifrahmen Nebst Anderen Statisch Unbestimmten Systemen - –kologie Und Urbane Lebensweise - Fremden Feindlichkeit - Wahlen Und Whler - Eine Frau Und Die Mathematik 19331940 - Einschwingvorgnge Gegenkopplung Stabilitt - Die Hormone Ihre Physiologie Und Pharmakologie - Grundzge Der Rntgendiagnostik - Hllen-inszenierung „wrestling - –kologie Und Wasserbau - Kontext Und Kontingenz - Erfolgreicher Unternehmensverkauf - Bav - Der Neue Versorgungsausgleich - Kleines Wrterbuch Der Marxistisch-leninistischen Philosophie - Die Strategische Ohn- Macht Der Friedensbewegung - Rate Adaptive Cardiac Pacing - Europa 2020 - Optimization For Industrial Problems - Die Behandlung Der Chronischen Encephalitis Epidemica Parkinsonismus Mit Der „bulgarischen Kur - Hrer Durch Die Technische Mechanik - Dampfturbinenschaufeln - Fernsehgewalt - Mathematical Physics X - Humankologie - Publizieren - Interactive 3d Multimedia Content - Brgerliches Recht Betriebswirte - Der Bau Des Dieselmotors - Neuere Anstze Zur Diagnostik Und Therapie Schizophrener Minussymptomatik - Aids And Obstetrics And Gynaecology - Genderkompetenz In Supervision Und Coaching - Enzyme Handbook 7 - Sozialpolitik Und Soziale Lage In Deutschland - Thermische Solaranlagen - Shock Sepsis And Organ Failure Nitric Oxide - Sexology - Terrigenous Mass Movements - The Chinese Face In Australia - Der Verband - Freiwilligenagenturen In Deutschland - Starthilfe Physik - Das Harz Der Nadelhlzer Seine Entstehung Vertheilung Bedeutung Und Gewinnung Forstmnner Botaniker Und Techniker - Spielen In Virtuellen Welten - Aquaculture Management - Weltordnung Durch Us-leadership - Systematisches Projektieren Und Konstruieren - Biologische Psychiatrie Der Gegenwart - Lehmbau - Der Plan Als Befehl Und Fiktion - Der Deutsche Bundestag Im Wandel - Innovationsrisikomanagement Im Krankenhaus - Wie Die Medien Die Wirklichkeit Steuern Und Selber Gesteuert Werden - Jahrbuch Der Hafenbautechnischen Gesellschaft - Aktuelle Neuropdiatrie 1989 - Theorie Als Kampf - Fluktuationen Und Dynamik Aktiver Halbleiter-bauelemente - Pulse Waves - Grund- Und Wasserbau In Praktischen Beispielen - Optik Des Menschlichen Auges - The Implantable Cardioverterdefibrillator - Die Selbstttige Regelung In Der Elektrotechnik - Erfolg Durch Vertrauen - Vob-musterbriefe Auftragnehmer - Regieren In Der Bundesrepublik Iii - Die Reorganisation Der Fabrik Und Die Wiederentdeckung Der Arbeit - Ditetische Kche Klinik Sanatorium Und Haus - Regierungssystem Und Verwaltungspolitik - Mikrosoziologie - Digitalisfibel Den Arzt - Atlas Zur Spurenkunde Der Elektrizitt - Motor Neuron Disease - Milieu Urbanitt Und Raum - Animal Acoustic Communication - Mathematische Algorithmen Im Unterricht - Arbeiten Mit Ms-dos Qbasic - Dampfturbinen-verbrauchsdiagramme - Neue Generation Neues Erzhlen - Numerische Algorithmen In Softwaresystemen - Die Archologie Der Zeit - Sammlung Der Internationalen Vereinbarungen Der Lnder Der Bundesrepublik Deutschland - Arduino And Kinect Projects - Bakteriologische Grundlagen Der Chemotherapeutischen Laboratoriumspraxis - Neuropsychologie - Die Akropolis Von Athen - Nachhaltige Nutzung Von Wrmeenergie - Wolfgang Abendroth Wissenschaftlicher Politiker - Risk Assessment For Deliberate Releases - Pierre Bourdieus Konzeption Des Habitus - Jugend Privat - Handbuch Zur Gleichstellungspolitik An Hochschulen - Zeitreihenanalyse In Den Wirtschaftswissenschaften - Krankenernhrung - Bauakustik - Testosterone - Die Metallischen Werkstoffe Des Maschinenbaues - The Unesco Convention On The Protection And Promotion Of The Diversity Of Cultural Expressions - Die Beiden Deutschen Staaten In Der Dritten Welt - Handbuch Der Zahnheilkunde - –kologisches Entwicklungspotential Der Bergbaufolgelandschaften Im Niederlausitzer Braunkohlerevier - Readings In Multiple Criteria Decision Aid - Bibliographie Zur Deutschen Soziologie - Cardiovascular Aspects Of Marfan Syndrome - Methodologie Methoden Forschungsdesign - Handbuch Der Katalyse - Hebammenlehrbuch - Elementarmathematik Griffbereit - Ansthesiologische Besonderheiten Bei Kindern Mit Syndromen Und Seltenen Erkrankungen - Die Chemie Der Kohle - Der Gesetzgeber Und Die Gentechnik - Advanced Robotics 1989 - Pro Sharepoint 2010 Development For Office 365 - Das Rztliche Gutachten Im Versicherungswesen - Krisenmanagement In Der Gmbh - Wieviel Management Braucht Der Mensch - Handbuch Marketing-kommunikation - Export Import Spedition - Das Rtsel Des Masochismus - Finanzinstrumente Im Ifrs-abschluss Von Nicht-banken - Die Lage Des Chequewesens In Deutschland - Jugendliche Video-cliquen - Handlungstheorie Und Politische Kultur - Medien Und Fremdenfeindlichkeit - Betriebsvorschriften Drogen- Und Gifthandlungen In Preuyen - Duration And Change - Anleitung Zum Frischhalten Der Lebensmittel - Homogenization Of Differential Operators And Integral Functionals - Europisches Steuerrecht - Leitfaden Zur Eisenhttenkunde - Die Zukunft In Amerika - History Of Social Work In Europe 19001960 - Virus- Und Rickettsieninfektionen Des Menschen - Astronomische Miniaturen - Parallele Numerik - Einhrung In Eis- Schnee- Und Lawinenmechanik - Grundbau - Handbuch Der Deutschen Arzneipflanzen - Chemie Der Zuckerindustrie - Technik Arbeit Betrieb Gesellschaft - Einhrung In Die Fuzzy-logik - Wohnstandortprferenzen Und Mobilittsverhalten - Feministische Staatstheorie - Kreativitt Utopie Und Erziehung - The First Twelve Weeks Of Gestation - Die Befragung Im Kontext Von Raum Zeit Und Befindlichkeit - Kommunikationsverhalten Und Geschlecht - Mitarbeiter Im Auslandseinsatz - Jugend In Ostdeutschland Lebenssituationen Und Delinquenz - Papierchromatographie In Der Botanik - Frankreich-jahrbuch 1988 - Soziologie Des Selbstmords - Anleitung Die Polizeilichen Revisionen Der Metzgerte Vom 22 Juli 1925 - Mikrokologische Prozesse Im System Pflanze-boden - Gender Medienkompetent - Excel 40 - Der Dauerwald - Arbeitsmarktpolitik - Effekte Eines Gerontopsychiatrischen Zentrums Auf Das Regionale Versorgungssystem Psychisch Gestrter Lterer Menschen - Die Berechnung Statisch Unbestimmter Tragwerke Nach Der Methode Des Viermomentensatzes - Project Management With Dynamic Scheduling - Medien Kinder - Management Im Vernetzten Unternehmen - Teilhaben An Schule - Klinische Epikrisen - Dampfkessel-feuerungen Zur Erzielung Einer Mglichst Rauchfreien Verbrennung - Allgemeine Und Spezielle Elektrochirurgie - Biologie Des Menschen - Antisemitismus In Der Bundesrepublik Deutschland - Klinik Und Therapie Der Vegetativen Funktionsstrungen - Powered Flight - Fortschritte Der Praktischen Geologie Und Bergwirtschaft - Inside Wall Street - Seilschwebebahnen - Lindenstraye - Aktuelle Aspekte Medienpdagogischer Forschung - Afrika Jahrbuch 2002 - Analysis And Simulation Of Semiconductor Devices - Streitgesprche - Afrika Jahrbuch 1995 - Lust Auf Zukunft - Deutschland In Europa - Der Petroleum-ingenieur - Pediatric Metabolic Syndrome - Superplasticity Of Alloys Intermetallides And Ceramics - Bauplanung Mit Din-normen - Marke Mit System - Medienstadt - Inflammatory Breast Cancer An Update - Die Untersuchung Der Arzneimittel Des Deutschen Arzneibuches 6 - C Net Mit Methode - Fields And Particles - Die Feinplanung Von Dv-systemen - Publikums- Und Wirkungsforschung - Food Analysis - Weiybuch Bildung - Handbuch Medienerziehung Im Kindergarten - Die Holzbaukunst - Risikoorientierte Bauprojekt-kalkulation - Banken Und Moral - Parteimitglieder Im Wandel - Nationalsozialismus Und Schule - Statistische Datenanalyse Mit Spsspc+ - Die Vlker Der Ehemaligen Sowjetunion - Scientific Visualization Of Physical Phenomena - Armut Von Kindern Mit Migrationshintergrund - Das Verbrechen Ii - Die Oxydativen Grungen - Psychotherapie In Zeiten Der Vernderung - Pierre Bourdieu Neue Perspektiven Die Soziologie Der Wirtschaft - Methodologie Der Sozialwissenschaften - Operationsverstrker - Die Quantentheorie - Shock Waves @ Marseille I - Advances In Autonomous Mini Robots - Praktische Baustatik - Die Feldschwchung Bei Bahnmotoren - Beratung Von Organisationen - Judentum Und Kommunismus - Management In A Dynamic Environment - Cytopathology - Fremdenfeindliche Gewalttter - Biologic Rhythms In Clinical And Laboratory Medicine - Altern Und Gesellschaft - Amputationschirurgie Und Rehabilitation - Leadership By Soft Skills - Das Fassungsvermgen Von Rohrbrunnen Und Seine Bedeutung Die Grundwasserabsenkung Insbesondere Gryere Absenkungstiefen - Handbuch Der Normalen Und Pathologischen Physiologie Fortpflanzung Entwicklung Und Wachstum - Das Neue Deutsche Regierungssystem - Medizinische Und Therapeutische Kommunikation - Parlamentarische Mitsteuerung - Modeling Simulation And Optimization Of Complex Processes - Das Maple Arbeitsbuch - Der Coronarkreislauf - Sampling Of Powders And Bulk Materials - Principles Of Dispersal In Higher Plants - Repertorium Der Theorie Der Differentialgleichungen - Magnetic Resonance - Dynamischer Wettbewerb - Kulturen Des Kompromisses - Handbook Of Space Security - Politik Besser Verstehen - Inflation Und Geldentwertung - Das Abc Des Selbstmanagements - Auyenpolitik Und Auyenwirtschaft Der Volksrepublik China - Satellite Hydrocarbon Exploration - Die Berechnung Von Rotierenden Scheiben Und Schalen - Datennetztechnologien Next Generation Networks - Pouch - Ren© Knig Soziologe Und Humanist - Die Kunst Der Demotivation - Management Im Ffentlichen Sektor - Net Value - Lessons Learned From Long-term Soil Fertility Management Experiments In Africa - Bank- Und Finanzwirtschaft - Jugendtrends In Ostdeutschland Bildung Freizeit Politik Risiken - Deutschland Im Soziokonomischen Systemvergleich - Geschichte Der Politischen Ideen - Sozialisation In Den 90er Jahren - Erbbiologie Und Erbpathologie Nervser Und Psychischer Zustnde Und Funktionen - Ostprofile - Bildungserfahrungen An Montessorischulen - Alex - „der Rckblick Auf Die Vergangenheit Wird Sich Nicht Vermeiden Lassen - Ergebnisse Der Chirurgie Und Orthopdie - Modernisierung Des –ffentlichen Dienstes - Aufgaben Physikalische Schlerbungen - Konstruktion Und Material Im Bau Von Dampfturbinen Und Turbodynamos - Identitt Und Rolle - The Design Of A Microprocessor - Macht Und Moral - Elektrochemie - In Der Sprache Der Tter - Dehnungsmeystreifentechnik - Tragwerke Aus Aluminium - Modernes Personalmanagement - Fragrances - Mri In Der Gynkologie Und Geburtshilfe - Nach Pisa - Structure And Function In Normal And Abnormal Hips - Einhrung In Die Differential- Und Integralrechnung Nebst Differentialgleichungen - Soziologische Theorie Und Geschichte - Grenzberschreitungen - Vom Elfenbeinturm Ins Rampenlicht - Karriere In Der Finanzwelt - Tunnelbau - Gummifreie Isolierstoffe - Theorie Der Sozialen Gruppe - Festband Zum 70 Geburtstag Von Rolf Nevanlinna - Urbanitt - Kombinierte Geverbindungen - Betriebs-handbuch Bhr 64 Pittler-revolverdrehbnke - Viral Marketing - Implizite Logiken Des Pdagogischen Blickes - Der Weg Zum Kufer - Klausurtraining Statik - Die Verwaltung Der Ffentlichen Arbeiten In Preuyen 1900 Bis 1910 - Lehrbuch Der Markscheidekunde - Power Sonic And Ultrasonic Transducers Design - Der Hochbau - Management Von Marktpreis- Und Ausfallrisiken - Alterssportmedizin - Ernst Curtius - Kreisfrmig Gekrmmte Trger Mit Starrer Torsionseinspannung An Den Auflagerpunkten - Die Institution Schule Und Die Lebenswelt Der Schler - New Concepts In Viral Heart Disease - Urinary Enzymes - Sexuelle Gewalt Gegen Behinderte Menschen Und Das Recht - Heart-brain Interactions - Calciumantagonisten - Energy Transport And The Environment - Die Kalkulation Und Organisation In Frbereien Und Verwandten Betrieben - The Developing Marsupial - Das Giessen Von Messingblcken - Parallelitt Und Transputer - Die „erfolgsspirale Der Ungleichzeitigkeit - Miyverstndnisse In Gesprchen - Leitfaden Der Medizinisch-klinischen Propdeutik - Regel-transduktoren - Journalistinnen In Europa - Conservation Of Living Nature And Resources - Benzin Benzinersatzstoffe Und Mineralschmiermittel Ihre Untersuchung Beurteilung Und Verwendung - Was Ist Subsidiaritt - Schichttypische Benachteiligung Im Allgemeinen Bildungswesen - Wundinfektionen In Der Gefychirurgie - Grundkurs Theoretische Physik 6 Statistische Physik - Crystalline Bacterial Cell Surface Layers - Mglichkeitssinn - Die Spinnerei In Technologischer Darstellung - Carl Schmitt Und Die Liberalismuskritik - –kologische –konomie - Grundlagen Der Statistik Und Ihre Anwendungen - Illustrated C 2012 - Das Sas Survival Handbuch - Wachsende Stadt - Stochastische Prozesse Ingenieure - Differentialoperatoren Der Mathematischen Physik - Kleiner Ratgeber Den Apothekenkauf - Perspektiven Der Arrhythmiebehandlung - Politik Und Bedeutung - Numerical Modelling Of Material Deformation Processes - Kompetenzmanagement In Der Praxis - Formale Semantik Und Natrliche Sprache - Trans-atlantik Trans-portabel - Lernen In Der Informationsgesellschaft - Elektrische Stoyfestigkeit - Practical Issues In Anesthesia And Intensive Care - Cerebral Ischemia And Basic Mechanisms - Der Strategie-scout - Zuwanderung Und Integration - Journalistik - Die Chirurgie Des Mensurbodens - Gold And Other Precious Metals - Bericht Ber Die Sechsundvierzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1927 - Motivation Und Begeisterung - Krankheiten Des Herzens Und Der Gefβe - Umweltgerechte Verkehrskonzepte - Wrme- Und Klteschutz - Genetic Engineering 3 - Teamintelligenz Ein Intelligentes Team Ist Mehr Als Die Summe Seiner Kompetenzen - Die Wertheim-studie - Surgical Endodontics - Dermatologie Und Rheuma - Soziale Beziehungen Im Migrationsverlauf - Management Und Bilanzierung Von Emissionsrechten - Erfolgreiches Change Management In Der Post Merger Integration - Der Psychopath - Functional Analysis And Economic Theory - Die Vorbereitung Zu Chirurgischen Eingriffen - Die Chronisch Erhht Gefhrlichen - The Changing Faces Of Ireland - Verdichtungsrume - Berechenbarkeit Komplexitt Logik - Environmental Hygiene Iii - Dictionary Of Food And Ingredients - Project Engineering - Photoelasticity - Baukalkulation Und Projektcontrolling - Chronik Der Kinderradiologie - Elternkurse Auf Dem Prfstand - Die Montage Im Flexiblen Produktionsbetrieb - Latex Vademecum - Nonlinear Analysis Of Physiological Data - Der Eigenbedarf Mittlerer Und Groyer Kraftwerke - Auto Und Verkehr Bis 2000 - Das Prdikat Im Deutschen - Analysis In Dimension 1 - Klausuren Brgerliches Recht - Sportmedizin Kursbestimmung - Rechneruntersttztes Projektieren Und Konstruieren - Prostaglandins And The Uterus - Kritik Des Zeitstudienverfahrens - Weiterbildung In Kreditinstituten - Sedimentary Basins - Kern- Und Radiochemie - Klassiker Der Pdagogik - Psychological Treatment Of Mental Illness - Wahl Der Nahrungsproteinegrundlagen Und Ditetik - Der Unscharfe Ort Der Politik - Mobile Business - Pet And Petct Study Guide - Cad Referenzmodell - Prognosefhiger Erfolg Nach Iasifrs - Perforierende Keratoplastik - Die Moderne Stanzerei - Die Aktive Auyen- Und Sicherheitspolitik Der Rot-grnen Bundesregierung 1998-2005 - Kommutatorkaskaden Und Phasenschieber - Krper Sport Und Religion - Algebra Funktionalanalysis Und Codierung - Pneumologische Umweltmedizin - Programm Zukunft - 1+1=10 Mathematik Hhlenmenschen - Spectral Synthesis - Design Methods For Digital Systems - Von Welchen Supply-chain-management-maynahmen Profitieren Automobilzulieferer - Biochemistry Of Cell Walls And Membranes In Fungi - Advances In Neurochemistry - Stakeholdermanagement In Der Unternehmenskrise - Der Gegenstand Der Psychologie - Neue Kommunikationsnetze - „lter Werdende Und Ltere Frauen Heute - Treatise On Heavy Ion Science - Die Lagersttten Nutzbarer Mineralien - Produktgestaltung - Gynkologie Und Geburtshilfe 1988 - Quantum Fields Algebras Processes - Aufgabensammlung Elektrotechnik 1 - Die Russische Hunger- Und Seuchenkatastrophe In Den Jahren 19211922 - Biomechanics In Orthopedics - Fit Im Bro - Citizenship - Soziologie Der Staatsbrgerschaft - Ergebnisse Der Exakten Naturwissenschaften - Grundlagen Der Arbeitsorganisation Im Betriebe Mit Besonderer Bercksichtigung Der Verkehrstechnik - Hydrothermal Mineral Deposits - Cosmic Plasma Physics - Bilder Und Skizzen Aus Der Geschichte - Die Methode Der Festpunkte - Handbuch Des Materialprfungswesens Maschinen- Und Bauingenieure - Schlussbericht Der Enquete-kommission Recht Und Ethik Der Modernen Medizin - Hypertonie Und Herz - Kolloidchemische Grundlagen Der Textilveredlung - Heterogene Katalyse Ii - Bedeutung Und Wesen Des Patentanspruchs - Numerische Mathematik Ingenieure - Reformen In Wohlfahrtsstaaten - Grnderprocesse - Kultursoziologie - Natural Draught Cooling Towers - Karsthydrogeologie - Current Cardiovascular Drugs - Algebra Und Diskrete Mathematik Informatiker - Die Hchste Nerventtigkeit Das Verhalten Von Tieren - Manual Of Pelvic Surgery - Leitfaden Der Technischen Wrmemechanik - Gabler Lexikon Werbung - Studienbuch Politikwissenschaft - Gutachten Des Reichs-gesundheitsrates Betreffend Die Verunreinigung Der Orla Und Ktschau Durch Gewerbliche Abwsser - Advanced Intraoperative Technologies In Neurosurgery - Aachener Bausachverstndigentage 2003 - Discrete-time Linear Systems - Fehlzeiten Wirksam Reduzieren - Einhrung In Die Praktische Pharmazie Apothekerpraktikanten - Technology-rating - Innovationspotentiale In Der Produktentwicklung - Brgschaft Des Inneren Friedens - Die Schneidsthle - Zeigt Mir Was Ihr Knnt! - Genussrechte - Kinder-rituale Zwischen Vorder- Und Hinterbhne - Und Einstein Hatte Doch Recht - Ethik Als Pdagogisches Projekt - Computer Im Deutschen Bundestag - Heldenbilder Im Fernsehen - Boundary Element Methods In Engineering - Forever Young - Gastric Anisakiasis In Japan - –kosystemforschung Der Rhein Und Seine Auen - Kulturbetriebslehre - Fourier-optik Und Holographie - Embryologie Und Fortpflanzungsbiologie Der Angiospermen - Unternehmungskrisen - Die Chemische Untersuchung Und Beurtheilung Des Weines - Digitalrechner Grundlagen Und Anwendungen - Wieder Das Fusionsfieber - Mobilmachung Im Mittelstand - Chemical Physics Of Redox Metalloenzyme Catalysis - Unternehmensethik Konkret - Japan Europa Usa - Art Equality And Learning Pedagogies Against The State - Die Verwsserung Von Erdlfeldern Ihre Ursachen Und Bekmpfung - Handbuch Des Wasserbaues - Negative Versus Positive Schizophrenia - Holografie - Management · Werte Organisation - Medizinische Kommunikation - Edelrassen Des Waldes - Technikfolgen Abschtzen Lehren - Die Therapie Des Praktischen Arztes - Allergic Contact Dermatitis - Turbo Pascal 70 - Pflegebedrftigkeit Und Pflegesicherung In Ausgewhlten Lndern - Isdn Und Lokale Netze - Koordinaten-geometrie - Mindfulness And Acceptance In Couple And Family Therapy - Brgerliches Recht - E-markets - Nlp Im Business - Technisches Optimieren - Praktische Betriebslehre - Die Klinik Der Tuberkulose Erwachsener - Verstrkertechnik - Organisationen Und Netzwerke Der Fall Gender - Ko-evolution Von Gesellschaft Und Funktionalem Staat - Armutsforschung Und Sozialberichterstattung In Den Neuen Bundeslndern - Pro Sql Server 2008 Service Broker - Die Bedeutendsten Mrtelbildner In Deutschland - Unternehmensfinanzierung Mit Dem Kapital-dienstleistungsgrad - Furniere Lagenhlzer Und Tischlerplatten - Das Nordpolargebiet - Expertensystemshell Deduc Wissensdynamik Mit Deduc - Diphtherie Und Anginen - Remote Sensing Of The Earth From Space Atmospheric Correction - Numerik Gewhnlicher Differentialgleichungen - The Lec Rat - Pacific Crystal Centre For Science Mathematics And Technology Literacy Lessons Learned - Todesfuge - Streetball - Handbuch Des Geltenden –ffentlichen Und Brgerlichen Rechts - Fachbezogene Informationsverarbeitung - Die Grundbuchsachen In Der Gerichtlichen Praxis - Recovery From Brain Damage - Aerodynamic Theory - Stoffaufnahme · Stoffwanderung Wachstum Und Bewegungen - Die Wirklichkeit Des Rechts - Die Fabrikation Der Soda Nach Dem Ammoniakverfahren - The Course Of Eating Disorders - Die Registrierung Des Herzschalles - Data Expert Knowledge And Decisions - Der Ffentliche Personennahverkehr - Pro Oracle Spatial For Oracle Database 11g - Soziale Arbeit Und Medien - Nach Dem Crash Ist Vor Dem Crash - Entwurf Und Diagnose Komplexer Digitaler Systeme - Die Gewinnbeteiligung Der Arbeiter Und Angestellten In Deutschland - Anion Carriers Of Mitochondrial Membranes - Spezielle Magenchirurgie - Transport- Und Lagerlogistik - Wir Haben Uns Als Deutsche Gehlt - Evolutionary Biology Of Transient Unstable Populations - Umweltorientierte Marktwirtschaft - Vorbereitungsmaschinen Die Weberei - Psychophysiological Mechanisms Of Hypnosis - Politische Planung - Advances In Econometrics Income Distribution And Scientific Methodology - Theorietechnik Und Politik Bei Niklas Luhmann - Sozialstrukturen In Lateinamerika - Qualittszirkel Erfolgreich Gestalten - Deutsche Identitt Und Das Zusammenleben Mit Fremden - Dimensions Of Food - Mandantenorientierte Sachbearbeitung - Konstruktionspraxis Formgedchtnistechnik - Die Politischen Systeme Skandinaviens - Handbuch Kinder Und Husliche Gewalt - Weiterbildung Von Frauen In Den Neuen Bundeslndern - Drogen Und Stadtstruktur - Masterkurs It-management - Achtzehnjhrige Zwischen Reaktion Und Rebellion - Organisation - Vom Ordoliberalismus Zur Sozialen Marktwirtschaft - Events - Erlebnismarketing Alle Sinne - Brgerinitiativen Und Reprsentatives System - Bausteine Des Chaos Fraktale - Nahost Jahrbuch 1988 - Electrical Processes In Atmospheres - Dasselbe Noch Einmal Die „sthetik Der Wiederholung - Kundenclubs And More - Philosophieren Mit Kindern - Die Reichsgesetzlichen Bestimmungen Ber Den Verkehr Mit Arzneimitteln Ausserhalb Der Apotheken - Gerontology - Rekonstruktion Narrativer Identitt - Doing Modernity - Doing Religion - Optimale Produktions- Und Absatzplanung - Neuroprosthetics From Basic Research To Clinical Applications - Neue Finanzdienstleistungen - Silicone Oil In The Treatment Of Complicated Retinal Detachments - Prfungstrainer Mathematik - Nbd-prognosemodelle Im Kundenbeziehungsmanagement - Serien-welten - Organic Acids In Geological Processes - Raus Aus Der Demotivationsfalle - Prfungsvorbereitung It-berufe - Medienregulierung Durch Die Gesellschaft - An Introduction To Teichmller Spaces - Karriere Machen Vertrieb 2003 - Hochwertiger Grauguy Und Die Physikalisch-metallurgischen Grundlagen Seiner Herstellung - Die Brennkraftmaschinen - Kinderheilkunde Und Pflege Des Gesunden Kindes Schwestern Und Sorgerinnen - Systematic Geomorphology - Die Familienpolitik Muss Neue Wege Gehen! - Neuropeptides And Immunoregulation - Werkzeugmaschinen - Man Sollte Nicht Den Finger Der Auf Den Mond Weist Den Mond Selbst Halten - Praxis Der Psychodramatischen Supervision - Schreiben - Gender Mainstreaming In Sachsen-anhalt - Der Elektrische Lichtbogen Bei Gleichstrom Und Wechselstrom Und Seine Anwendungen - Zivilisation Und Rationalisierung - Investment - Annals Of Life Insurance Medicine - Salt And Hypertension - Die Europische Zentralbank - Einsame Spitze - Der Lastkraftwagenverkehr Seit Dem Kriege Insbesondere Sein Wettbewerb Und Seine Zusammenarbeit Mit Den Schienenbahnen - Mikrosystemtechnik Auf Silizium - Kurzes Lehrbuch Der Anorganischen Chemie - Die Alten Und Das Netz - Die Freien Hauttransplantationen - Feindbild Minderheit - Vertrauen Kooperation Netzwerkbildung - Werte Und Wertewandel In Westlichen Gesellschaften - Illustrated Encyclopedia Of Dermatology - Efficiency Institutions And Economic Policy - Mathematische Juwelen - Der Neue Mobile-commerce - Joint Ventures Im Chinesischen Kulturkreis - Datenstrukturen Objektorientiert Mit Modula-2 - Telefonstichproben In Deutschland - Bodenschtze Als Biologische Und Politische Faktoren - Soziologie Des Cyberspace - Sensory Hair Cells - Werte Und Nationale Identitt Im Vereinten Deutschland - Stadtentwicklung In Ostdeutschland - Staatsttigkeit - E-mail-marketing - Assembly Of Enveloped Rna Viruses - Raumdekonstruktionen - Spezielle Mineralogie Auf Geochemischer Grundlage - Lehrbuch Der Theoretischen Physik - Kommentar Zur Wrmeschutzverordnung 1995 - Progress In Proctology - Die Landwirtschaftliche Verwertung Stdtischer Abwsser - Lohas-marketing - Handbuch Der Drogisten-praxis - Re-design Von Wertkette Durch Make Or Buy - Antenatal Diagnosis Of Fetal Abnormalities - Kindheit In Armut Weltweit - Air Navigation Law - Beitrge Zum Verfassungs- Und Wirtschaftsrecht - Exotische Krankheiten - Macht Und Ohn-macht Im Management - Analogcomputer In Chemie Und Biologie - Elektrotechnische Meykunde - Die Wissensordnung - Glocal Governance - Stabilitt Und Wandel Von Parteien Und Parteiensystemen - Vergessen Sie Alles Ber Verkaufen - Einhrung In Die Elektronik - Marken Und Sport - Intention Bedeutung Kommunikation - Atlas Umgeformter Metallischer Oberflchen - Berufsfindungsprozesse Von Mdchen Und Jungen Frauen - Der Betonpfahl In Theorie Und Praxis - Arbeitsmarkt Und Wettbewerb - Biomonitoring Of Trace Aquatic Contaminants - Human-environment Relations - Organoselenium Chemistry I - Projektmanagement Als Organisationales Lernen - Selenium In Biology And Medicine - Kreditsicherheiten - Berechnung Des Eisenbetons Gegen Verdrehung Torsion Und Abscheren - Betrieb Von Elektrizittswerken - Einhrung In Die Akustik - Physik Mediziner - Adolescent Parenthood - Internetrecht - Die Saponine - Die Abwrmeverwertung Im Kraftmaschinenbetrieb - Gatt Negotiations And The Political Economy Of Policy Reform - Abwasserhydraulik - Die Konstruktion Von Feindbildern - Demokratie Und Das Sdliche Afrika - Afrika Jahrbuch 2003 - Die Hochspannungs-gleichstrommaschine - Ocean Space Utilization 85 - Bacterial Adhesion - Vernetzte Organisationen - Clinical Aspects Of Blood Viscosity And Cell Deformability - Solvency Ii And Risikomanagement - Physics Of Thin Films - Hydrogeologische Untersuchungsmethoden Von Altlasten - Heterogene Katalyse I - Der Eisenbahngtertarif In Der Volkswirtschaft - Urinary Cytology - Software Development And Reality Construction - Familie - Schule Und Beruf - Pestizide Und Umweltschutz - Automatische Fahrzeuggetriebe - Energiesparendes Bauen - Algorithms For Graphics And Image Processing - Das Pneumencephalogramm - Ursachen Saisonaler Holzpreisschwankungen - Identification Of Materials - Elektronische Information In Der Hochschulausbildung - Sprache Des Deutschen Parlamentarismus - Elektrische Starkstromanlagen Maschinen Apparate Schaltungen Betrieb - Das Versuchswesen Auf Dem Gebiete Der Pflanzenphysiologie Mit Bezug Auf Die Landwirthschaft - Elektronenmikroskopische Hmatologie - Politische Reprsentation Schwacher Interessen - Caddy Grundkurs - Grundwissen Sozio-marketing - Differenziertes Performance Measurement In Supply Chains - Grundlagen Und Methoden Der Periodenforschung - Vorrichtungsbau - Lehrbuch Der Topographischen Anatomie - Kurzer Leitfaden Der Bergbaukunde - Perestrojka Pass© - Erkrankungen Der Kieferhhle - Das Seltsame Problem Der Weltgesellschaft - Population Genetics And Evolution - Werkstoffe Der Elektrotechnik - Dieselmotoren In Der Elektrizittswirtschaft Insbesondere Spitzendeckung - Evozierte Potentiale Im Verlauf - Einhrung In Die Physikalische Chemie Biochemiker Mediziner Pharmazeuten Und Naturwissenschaftler - Optimale Standortwahl Im Einzelhandel - Der Einkauf Als Margenmotor - Leib Krper Und Identitt - Handbuch Industrieroboter - Lexikon Management - Physik Und Umwelt - Quantitative Genetik - Die Grundlagen Der Verkehrswirtschaft - Deutschland Und Polen Eine Werte- Und Interessengemeinschaft - Strmung Durch Rohre Und Ventile - Public Relations Von Finanzorganisationen - Marktchancen Des Digitalen Fernsehens - Hallgeneratoren - Social Branding - Achieving Systems Safety - Physiologie Und Funktion Von Pflanzenwurzeln - Unternehmerischer Wandel - Netzhautabhebung - Riskante Entscheidungen Und Katastrophenpotentiale - Quantum Mechanics On The Personal Computer - Regionale Akteursnetzwerke - Mtterspiegel - Einhrung In Die Historisch-vergleichende Soziologie Max Webers - Gabler Versicherungs Lexikon - Wirtschaftspolitik Kompakt - Biologische Auswertungsmethoden - Parteien Kulturen Und Konflikte - Die Innovative Behrde - Einhrung In Die Lineare Und Nichtlineare Optimierung Ingenieure - Metriken - Der Schlssel Zum Erfolgreichen Security Und Compliance Monitoring - Markt-management - Mehrfeldrige Zweistegige Plattenbalkenbrcken - Expertinnen Machen Schule - Mediatisierte Welten - Approaches To The Clivus - Introduction To Abdominal Ultrasonography - Privatheit Garten Und Politische Kultur - Juristische Logik - Skandal Massenarbeitslosigkeit - Gatt Und Neue Welthandelsordnung - Wege Zur Macht - Die Interferenzen Von Rntgen- Und Elektronenstrahlen - Grenzgeschwindigkeiten Und Ihre Paradoxa - Pltzlicher Herztod - Gestaltung Des Sozialen Eine Herausforderung Europa - Die Prfung Der Arzneistoffe Nach Dem Deutschen Arzneibuch - Brennpunkt Plenum - Vasopressin - Smiths Sea Fishes - Alternative Weltordnungsmodelle - Milde Hypertonie - Physiotherapie - Ingenieurmathematik Kompakt Mit Maple - Elektronik 1 - Animal Lectins Form Function And Clinical Applications - Beschftigungsrisiko Erziehungsurlaub - Functional Morphology Of The Endocrine Heart - Leitfaden Der Therapie Der Inneren Krankheiten - Ungleichheit Soziale Beziehungen Und Gesundheit - Cerebral Ischemia And Calcium - Computer Und Menschliches Verhalten - Vektoranalysis - The Physics Of Optical Recording - Handbuch Bankorganisation - Das Bild Des Kranken - Handbuch Rechtsradikalismus - Silicon In Polymer Synthesis - Total Quality Management As A Holistic Management Concept - Vom Ornament Zum Nationalkunstwerk - Druck Und Stress Im Vertrieb Positiv Nutzen - Stahlbau - Digitale Rechenanlagen - Die Moderne Groystadt - Eigenkapitalfinanzierung - Handbuch Der Landmaschinentechnik - Krise Und Zukunft Des Sozialstaates - Illustrated Computer Tomography - Finanzvertrge Und Finanzintermediation - Handbuch Klebtechnik 20102011 - Bestimmungsmethoden Enzyme - Medien-ethik - Progress In Pacific Polymer Science 3 - Walther Gerlach 18891979 - High Value Management - Das Konzept Der Solidaritt - Sexuelle Szenen - Portal Hypertension - Seafood Proteins - Protein-calorie Malnutrition - Topographic Brain Mapping Of Eeg And Evoked Potentials - Rohrleitungs- Und Apparatebau - Bone Transplantation - Bauwerksabdichtung In Der Altbausanierung - Investment Banking - Politik Als Kampagne - Hlen Und Hren - Autonome Neuropathie Bei Diabetes Mellitus - Bifurcation And Chaos In Engineering - Der Gift- Und Farbwaaren-handel - Kaiser Wilhelm 17971877 - Die Chirurgischen Indikationen In Der Nervenheilkunde - Arbeitsbltter Friseure 3 - Nuclear Simulation - Innere Medizin - Komprimiertes Kennzahlen-know-how - Geld Und Geschlecht - Philosophy Mathematics And Modern Physics - Kanzler Und Minister 1949 1998 - Gasdynamik Der Verbrennung - Manual Of Disaster Medicine - User Experience Innovation - Kostbarkeiten Aus Dem Deutschen Apotheken-museum Heidelberg Treasures From The German Pharmacy Museum Heidelberg - Die Geschichtliche Methode In Der Forstwirtschaft - Nachhaltiges Personalmanagement - Erziehung Durch Arbeit - Kognitive Verhaltenstherapie Depressiven Grbelns - Die Verhtung Von Gesundheitsschdigungen Durch Anklopfmaschinen Die Verhtung Der Anklopferkrankheit - Handlungswissen Der Sozialen Arbeit - Fundamentals Of Plant Breeding - Schriftlichkeit Und Gesellschaft - Herrschaft Und Soziale Ordnung - Neurasthenie - Laseranwendungen - Umwelt- Und Technikkonflikte - Analyse Der Azofarbstoffe - Antarctic Ecosystems - Innovation In Esophageal Surgery - Kognitive Systeme - Der Besitz Venetiens Und Die Bedeutung Des Neu-italischen Reiches - European Data Protection In Good Health - Fit Von 1 Bis Hundert - Die Aussichten Von Zwanglaufkesseln - The Berlin Creative Industries - Projektierung Und Rationalisierung Von Kohlenbergwerken - Strategisches Affinity-group-management - Migration Zu Windows 2000 - Acht- Und Neunstellige Tabellen Zu Den Elliptischen Funktionen Eight And Nine Place Tables Of Elliptical Functions - Systematische Klassifikation Der Massengesteine - Sprachprozesse Und Wissensstrukturen - Gleitlager - Enzymkatalyse - Mob Oder Souvern - Metallurgische Berechnungen - Das Glyzerin - Planung Die Deutsche Einheit - Handbuch Biologische œbungen - Das Prinzip Unschrfe - Der Flotations-prozess - Diagnostik Und Therapie Der Pulpakrankheiten - Diagnostische Hmatologie - Energieversorgung Elektrischer Bahnen - Erwerbsarbeit Und Unterhaltswirtschaft - Arƶnei Als Wert - Berufs- Und Karriereplaner Medien Und Kommunikation 20032004 - Betriebliche Soziale Arbeit - Heterocyclic Chemistry - Steuerung Von Netzwerken - Risiko Kreditklemme - Kinderpsychotherapie In Der Praxis - Human Resources Management In Banken - Die Informationsrevolution - Economic Theory Of Fuzzy Equilibria - Mathematical Modeling And Scale-up Of Liquid Chromatography - Erfolgreiches Markenmanagement - Junge Ostdeutsche Auf Der Suche Nach Der Freiheit - Laparoscopy And Imaging Techniques - Die Geschichte Der Kinderheilkunde - Kanaldichtungen - Mathematikunterricht In Der Sekundarstufe Ii - Synaptic Plasticity In The Hippocampus - Der Geburtshilfliche Phantomkurs In Frage Und Antwort - Snack Food Technology - Die Wichtigsten Krankheiten Des Kaninchens - Der Kopfschmerz - Film- Und Fotoanalyse In Der Erziehungswissenschaft - Junge Familien In Der Bundesrepublik - Soziologie In Deutschland - Risk Analysis And Decision Processes - Redefining The Process Of Retirement - Das Verbrechen I - Prozessoptimierung Im Rechnungswesen - Leitfaden Der Bewegungsbestrahlung - Ideen Zu Einer Reinen Phnomenologie Und Phnomenologischen Philosophie - Towards One-pass Synthesis - Der Hrer In Die Lebermoose Und Die Gefykryptogamen - Bilanzpolitik - Surgery Of The Stomach - Wahrscheinlichkeitstheorie - Tatort Familie - Was Tun - Arends Volkstmliche Namen Der Drogen Heilkruter Arzneimittel Und Chemikalien - Modernes Netzwerkmanagement - Das Methoden-repertoire Von Lehrern - Chemie Des Waffen- Und Maschinenwesens - Anleitung Zur Qualitativen Appretur- Und Schlichte-analyse - Introduction To Mineralogy - Europische Integration Im Kontext Des Rechts - Orthopdische Erkrankungen Des Kindesalters - Mittelstand Hat Zukunft - Advances In Ct Iv - Europa Zwischen Ordnungswettbewerb Und Harmonisierung - Kinderreiche Mtter - Jugendarbeit Als Beruf - Das Schmiedbare Eisen - Stahl- Und Verbundkonstruktionen - Mechanische Technologie Der Metalle - Die Geologischen Grundlagen Der Verbauung Der Geschiebeherde In Gewssern - Die Gewerblichen Und Industriellen Abwsser - Die Ausstellung Als Marke - Welfare Economics And Social Choice Theory - Dynamik Der Geschlossenheit - Ziviler Friedensdienst Fachleute Den Frieden - Frauen Und Medien - Regionalkonomie - Advanced Electronic Circuits - Surgery Of Skull Base Meningiomas - Theorie Der Public Relations - Vergabepraxis Auftragnehmer - Bericht Ber Die Einundnfzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft - Kreisprozesse Der Gasturbinen Und Die Versuche Zu Ihrer Verwirklichung - Diagnostik Der Chirurgischen Nierenerkrankungen - Kulturrevolution - Die Lehre Vom Wirtschaftsbetrieb Allgemeine Betbiebswirtschaftslehre - Das Kraftfahrzeug - Die Klinik Der Beginnenden Tuberkulose Erwachsener - Literatur Als System - Soziale Kontrolle Und Individualisierung - Progress In Precision Engineering - Wirtschafts- Und Sozialkunde Versicherungsfachangestellte - Die Nachkalkulation Nebst Zugehriger Betriebsbuchhaltung In Der Modernen Maschinenfabrik - Formeln Und Fakten - Betriebliche Altersversorgung - Die Literarische Moderne In Europa - Einhrung In Die Klassische Und Intensionale Logik - Gewerkschaften Im Umbau Des Sozialstaats - Das Vieweg Latex2ε-buch - Baukonstruktion Im Planungsprozess - Handbook Of Marriage And The Family - Developments In Food Microbiology4 - Digital Teleretinal Screening - Genossenschaftliche Erziehung - Unfallforschung Unfallmechanik Und Unfallrekonstruktion - Electron Paramagnetic Resonance Of Exchange Coupled Systems - Katalyse Und Determinismus - Fremde Kulturen Im Europischen Fernsehen - Individuelle Freiheit Zum Wohle Aller - Innovation Without Rand D - Individualisierung Und Soziologische Theorie - Abc Des Molkereilaboratoriums - Anerkennung Und Gewalt An Schulen - Handbuch Bankcontrolling - Einhrung In Die Analysis - Liebe Am Ende Des 20 Jahrhunderts - Sleep Related Disorders And Internal Diseases - Mglichkeiten Und Grenzen Der Antineoplastischen Therapie - Lastverteilungszahlen Brcken - Eclogite Facies Rocks - Aus Der Praxis Der Kinderchirurgie - Exchange Server 2000 Installieren Konfigurieren Administrieren Optimieren - Geheimnisse - Semiconductor Physics - Turbulenzen Im Transformationsprozey - Die Niederspannungs- Und Hochspannungs-leitungsanlagen - Wirtschaftswrterbuch Diccionario Econ³mico - Das Europische Gleichgewicht Der Zukunft - Cardiovascular Diseases And Pregnancy - Die Theorie Der Bodensenkungen In Kohlengebieten Mit Besonderer Bercksichtigung Der Eisenbahnsenkungen Des Ostrau-karwiner Steinkohlenrevieres - Arbeiten Mit Kunststoffen - Die Pflanzenzucht Im Walde - Stochastik Mit Mathematica - Kartellrecht In Der Unternehmenspraxis - Gewalt In Huslichen Beziehungen - Infrastructure And The Space-economy - Investigation Of Anorectal Functional Disorders - Lernziel Konkurrenz - Blut Und Lymphe - Interaktionsformen - Umweltdermatosen - Die Ernhrung Gesunder Und Kranker Kinder „rzte Und Studierende Der Medizin - Kleben - Erfolgreich Und Fehlerfrei - Die Lehren Der Forstwissenschaft - Geburtshilfliche Operationslehre - Hydromechanik Der Gerinne Und Kstengewsser - Wer Verantwortet Den Industriellen Fortschritt - Kulturkampf Oder Friede In Staat Und Kirche - Strategie Und Sicherheitspolitik - Informationstechnologie Ingenieure - Massenmedien Und Lokaler Protest - Handbuch Der Feuerungstechnik Und Des Dampfkesselbetriebes - Youth And Housing In Germany And The European Union - Kommunikation Ber Kommunikation - Stochastische Prozesse - Sozialerziehung In Der Schule - Imagewirkungen Von Eventmarketing - Spielregeln Den Umgang Mit Chefs - Handbuch Des Bankmarketing - Klausurentrainer Technische Mechanik - Olfaction And Odours - Inszenierte Information - Die Biochemie Des Karzinoms - Allgemeine Und Spezielle Chirurgie Des Kopfes Einschliesslich Operationslehre Unter Besonderer Bercksichtigung Des Gesichts · Der Kiefer Und Der Mundhhle - Handwrterbuch Zur Politischen Kultur Der Bundesrepublik Deutschland - Robotersysteme 3 - The Foundations Of Acoustics - Demokratietheorie Und Politische Institutionen - Synchronization Of Eeg Activity In Epilepsies - Entwurf Robuster Regelungen - In Die Tiefen Des Weltalls - Viruskrankheiten Des Menschen - Terminal Ballistics - Die Differentialgleichungen Des Ingenieurs - Kinderrepubliken - Entwicklung Der Geburtshilfe Und Gynkologie Im 19 Jahrhundert - Aktive Kundenbeziehungen Mit Crm - Beginning C 50 Databases - Tragende Kunststoffbauteile - Einkommensteuerpflicht Und Einkommensteuerveranlagung Im Kriege - Standardisierung Der Bildung - Sachsen-anhalt In Europa Europa In Sachsen-anhalt - Die Krackverfahren Unter Anwendung Von Druck Druckwrmespaltung - Handbuch Europischer Kapitalmarkt - Management Im Gesundheitswesen - Elektrotechnik Und Witterung - Atmungs-pathologie Und -therapie - Analysis With Supercritical Fluids Extraction And Chromatography - Chancengleichheit Im Bildungswesen - Lebensstile Im Sozialstrukturellen Kontext - Bildung Und Beruf - Bauten Aus Beton- Und Stahlbeton-fertigteilen - Fraktionen Im Deutschen Bundestag 1949 1997 - Packetc Programming - Spanien - Die Absatztechnik Der Amerikanischen Industriellen Unternehmung - Die Einzelhaus-wasserversorgung - Coping And Self-concept In Adolescence - Frieden Und Sicherheit Im 21 Jahrhundert - Durchwurzelung Rhizodeposition Und Pflanzenvergbarkeit Von Nhrstoffen Und Schwermetallen - Carbohydrate Metabolism In Pregnancy And The Newborn · Iv - Mobile Gesellschaft Und Soziale Arbeit - Nuclear Radiation In Geophysics Kernstrahlung In Der Geophysik - Politische Bildung Und Globalisierung - Die Deflation Und Ihre Praxis In England · Den Vereinigten Staaten · Frankreich Und Der Tschechoslowakei - Infinite Horizon Optimal Control - Zwischen Drinnen Und Drauyen - Demokratie Lernen In Berlin - Transportversicherung - Die Kltemaschine - Produktions-management - Saunders Mac Lane Selected Papers - Angewandte Institutionenkonomik - Identification Of Lichen Substances - Computed Tomography - Medienrezeption - Jahrbuch Soziologiegeschichte 1990 - Anschauliche Quantentheorie - Gauge Theories Of The Strong And Electroweak Interaction - Neuordnung Der Lehrerausbildung - Eine Frage Des Geschlechts - Die Leberkrankheiten - Der Konstitutionstypus Als Genetisches Problem - Practice Questions In Psychopharmacology - Die Neueren Farbstoffe Der Pigmentfarben-industrie - Hrungsgrundstze Und Mitarbeiterhrung - Wer Kauft Was Warum Nicht - Moderne Staatsbrgerschaft - Der Neue Rechtspopulismus - –kologische Krise Und Marktmechanismen - Experiment Bei Gegenwind - Politische Bildung In Der Bundesrepublik - Intestinal Anisakiasis In Japan - Mikrowellenmesstechnik - Modern Aspects Of Electrochemistry - The Tropical Rain Forest - Lean-reporting - 101 Frauen Der Deutschen Wirtschaft - Jugend Und Gewalt - Die Heiz- Und Lftungsanlagen In Den Verschiedenen Gebudearten Einschlieylich Warmwasserversorgungs- Befeuchtungs- Entnebelungs- Und Klimaanlagen - Jenseits Von Halley - Armut Und Kindheit - Lehrbuch Der Forsteinrichtung Mit Besonderer Bercksichtigung Der Zuwachsgesetze Der Waldbume - Regionalisierung - Investitionsgtermarketing - Polyimides - Buchhrung Und Bilanzen - Die Edelmetalle - Der Rechtsstaat - Fernsehkultur - Literatursoziologie - Die Frequenzkennlinien - Generatives Verhalten Und Generationenbeziehungen - Geometrische Methoden In Der Theorie Der Gewhnlichen Differentialgleichungen - Theoretical Geomorphology - Studien- Und Forschungshrer - Cobol 85 Auf Dem Pc - Das Devisentermingeschft In Seinen Beziehungen Zur Whrung Und Wirtschaft - Der Durchlaufende Trger Ber Ungleichen –ffnungen - Font Technology - Kindheit Soziologisch - Die Therapie Der Syphilis - Die –lfeuerungstechnik - Physics Of Gravitating Systems I - Dein Mutmacher Bist Du Selbst! - Elektrotechnik Im Maschinenbau - Repetitorium Mathematik - Beitrge Zur Kenntniss Der Baumkrankheiten - Arthroscopy Of The Knee Joint - Allgemeinerkrankungen Infolge Schlechter Zhne - Arbeiten Im Virtuellen Zeitalter - Sport Science In Germany - Romantik Und Gewalt - Swarms Of Ions And Electrons In Gases - Dickwerden Und Schlankbleiben - Grundkurs Wirtschaftsinformatik - Geographic Information Systems Spatial Modelling And Policy Evaluation - Evolutionr Hren - Familienbilder - Tumormarker Und Immunszintigraphie In Der Gynkologischen Onkologie - Mnnlichkeit Und Gewalt - Marktwirtschaft - Lehrbuch Der Infektionskrankheiten „rzte Und Studierende - Modern Methods For Epidemiology - Vorlesungen Ber Statik Und Festigkeitslehre - Phytohormones And Abiotic Stress Tolerance In Plants - Initial Boundary Value Problems In Mathematical Physics - Die Stumme Myokardischmie - Carl Friedrich Gauss Werke - Diseases Of The Esophagus - Kritik Der Medien - Frankreich-jahrbuch 1990 - Analytische Erkenntnistheorie - Musikmobile Kulturarbeit Und Populre Musik - Journalistische Kultur - The South Atlantic - Der Steuerungs- Und Wohlfahrtsstaat Deutschland - Interkulturelle Kompetenz In Der Verwaltung - The Foundations Of Economics - Industrieelektronik - Einhrung In Das Marketing - Grundstze Ordnungsmyiger Verbindlichkeitsbilanzierung Arbeitsverhltnisse - Entgrenzte Rume - Erfahrene Demokratie Wie Politik Praktisch Gelernt Werden Kann - Betriebliche Informationskonzepte - Masterkurs Parallele Und Verteilte Systeme - Inorganic Nitrogen In Plants And Microorganisms - Elektronische Kommunikation X400 Mhs - Psychology Of Media In Europe - Lassalles Briefwechsel Von Der Revolution 1848 Bis Zum Beginn Seiner Arbeiteragitation - Pdagogik Des Mathematikunterrichts - Secondary Algebra Education Revisiting Topics And Themes And Exploring The Unknown - Recent Progress In The Chemical Synthesis Of Antibiotics And Related Microbial Products Vol 2 - Der High-tech-check Manager - Handwrterbuch Zur Lndlichen Gesellschaft In Deutschland - Talk Auf Allen Kanlen - Mythos Familie - Hafenanlagen Stckgutumschlag - Methoden Der Digitalen Bildsignalverarbeitung - Xith International Astronautical Congress Stockholm 1960 - Algebra I - Wahlkampf In Den Medien Wahlkampf Mit Den Medien - Die Arthrosis Deformans Des Kniegelenkes - Englisches Konversations-buch Pharmazeuten - Die Behandlung Innerer Krankheiten Mit Radioaktiven Substanzen - Heraus Forderungen Antworten - Wissenschafts- Und Erkenntnistheorie - Das Versagen Des Kreislaufes - Crystal Pulling From The Melt - Anatomie Und Pathologie Der Spontanerkrankungen Der Kleinen Laboratoriumstiere - Die Wirtschaftlichkeit Als Konstruktionsprinzip Im Eisenbetonbau - Technische Elektronik - Das Problem Der Entwicklung Unseres Planetensystems - Die Zoologie Der Trume - Blood Pressure Measurements - Durch Luhmanns Brille - Recent Developments In Particle And Field Theory - Grundlagen Der Technischen Mechanik - Aktiv Ins Sekretariat 2000 - Wirtschafts- Rechts- Und Sozialkunde Sekretrinnen - Die Seehafenpolitik Der Deutschen Eisenbahnen Und Die Rohstoffversorgung - Der Westliche Universalismus - Abwassertechnik - Dekonstruktion Von Geschlechtsidentitt Transversale Differenzen - Publikumsforschung - Weltpolitik Im 21 Jahrhundert - Bernhard Heines Versuche Ber Knochenregeneration - Lgner - Mathematik Bauingenieure - Institutionenkonomische Fundierung Effizienter Geldpolitik - Elemente Der Operatorenrechnung Mit Geophysikalischen Anwendungen - Geschichte Der Sozialen Ideen In Deutschland - Spirituality Education And Society - Geometrische Grundlagen Der Architekturdarstellung - Das Zentralnervensystem Des Menschen - Mathematische Grundlagen Der Hheren Geodsie Und Kartographie - Abschied Von Der Normalfamilie - Computernetze Frauenpltze - The Causation And Clinical Management Of Pelvic Radiation Disease - Serviceroboter - Die Edelstahlerzeugung - Complications Of Dermatologic Surgery - Der Schutz Der Demokratie In Deutschland Und Frankreich - Jahrbuch Verkaufstraining 9899 - Effektiv Starten Mit Turbo Pascal 60 - Arbeitswelten Von Morgen - Biographieforschung Und Kulturanalyse - Soziale Netzwerke Und Internet-spielewelten - Gekonnt Referieren œberzeugend Prsentieren - Eindrcke Aus Der Eisenindustrie Der Vereinigten Staaten Von Nordamerika - Die Zeit Des Politischen Entscheidens - Radioforschung - Altern Als ‚gesellschaftliches Problem‘ - Structure And Function Of Major And Minor Small Nuclear Ribonucleoprotein Particles - Neurochirurgische Operationen - Verdichtung Weltverlust Und Zeitdruck - Hren Lernen - Berechnung Und Konstruktion Der Dampfturbinen - Grundzge Der Eisenbahnwirtschaftslehre - Unternehmensgrndung Und Dezentralitt - Die Behandlung Der Quartren Syphilis Mit Akuten Infektionen - Die Grundlagen Den Vergleich Von Wrmeschutzangeboten - Inhaltsanalyse - Advances In Meat Research - Coronary Stents - Tron Project 1988 - Between Two Worlds” Hans Gerth - Praktischer Korrosionsschutz - Leadership - Best Practices Und Trends - Arbeitslosigkeit Und Wohlfahrtsstaat In Westeuropa - Demokratische Streitkultur - Sozialpsychologisches Organisationsverstehen - Beginning Facebook Game Apps Development - Advanced Android 4 Games - Exklusionsindividualitt - Fernsehen Als Objekt Und Moment Des Sozialen Wandels - Lokale Engagementfrderung - Alternativer Umgang Mit Alternativen - Transsophageale Echokardiographie Monoplanbiplan - Total Quality Banking - Die Chemie Bearbeitet Als Bildungsmittel Den Verstand - Politische Theorien In Russland - Neutrino - Speed Selling - Die Ermittlung Der Kegelrad-abmessungen - Robotersysteme 2 - Gynkologische Operationen - Grundkurs Java-technologien - Fachrechnen Bauzeichner - The New World Of Economics - Die Kulturelle Bedeutung Der Komplexen Psychologie - Traumatic Hip Dislocation In Childhood - Laplace- Fourier- Und Z-transformation - Service Experience Value - Das Vervollstndigte Cross-verfahren In Der Rahmenberechnung - Reformprozesse Im Bildungswesen - Prostatitis - Die Lungentuberkulose - Kranbahntrger Aus Walzprofilen - Kultur Im Widerspruch - Das Wissen Des Bankkaufmanns - Breast Cancer 4 - Unix-werkzeuge - Mit Dem Kranken Partner Leben - Integrierte Industrielle Sach- Und Dienstleistungen - Hochofen-begichtungsanlagen - Jugendliche In Marginalisierten Quartieren - Deutschlandpolitik In Der Ffentlichen Meinung - Die Akuten Infektionskrankheiten Des Kindesalters - Quality Of Life Assessment International Perspectives - Albert Einstein Wirkung Und Nachwirkung - Schlagfertig Im Verkauf - Praxis Der User Interface-entwicklung - Kreditrisikotransfer - Die Dreiteilige Groystadt Als Heimat - Die Drehzahl-normung Und Ihre Wirtschaftliche Auswirkung Im Drehbankbau - Spielrume In Der Konstruktion Von Geschlecht Und Familie - Familie Als Beruf Arbeitsfeld Der Zukunft - The Contextual Challenges Of Occupational Sex Segregation - Praktikum Der Pflanzenanatomie - Die Forstliche Bestandesgrndung - Die Pflanzenalkaloide - Alles Was Sie Schon Immer Ber Ihr Geld Wissen Wollten - Der Temperguy - Die Treibmittel Der Kraftfahrzeuge - Das Knigliche Materialprfungsamt Der Technischen Hochschule Berlin Auf Dem Gelnde Der Domne Dahlem Beim Bahnhof Gross-lichterfelde West - Satellitentechnik - Datenbertragung Technik Der Daten- Und Textkommunikation - Mythos Globalisierung - Size-structured Populations - Gttinger Risiko- Inzidenz- Und Prvalenzstudie Grips - Artificial Liver Support - Concurrent Simultaneous Engineering Systems - Programmieren Spielend Gelernt Mit Dem Java-hamster-modell - Management Jenseits Der Postmoderne - Terroristische Diktaturen Im 20 Jahrhundert - Politische Institutionalisierung Und Konflikttransformation - Politische Steuerung - Atlas Of Brain Mapping - Soft Skills Freelancer - Frderung Von Kindern Mit Migrationshintergrund - Fortschritte Der Botanik - Arteriosclerosis - Elektrische Reaktions-audiometrie - Mr Mammography Mrm - Advances In Human Genetics 10 - Strukturpolitik Zwischen Tradition Und Innovation Nrw Im Wandel - Heart Failure And Arrhythmias - Dv-controlling Bei Finanzdienstleistern - Aufgaben Und Fortschritte Des Deutschen Werkzeugmaschinenbaues - Gesetz Betreffend Den Forstdiebstahl Vom 15 April 1878 Mit Erluterungen - A Course In Complex Analysis - C++ Programmierer - Reducing Co2 Emissions - Zwischen Alltag Und Utopie - Lehrbuch Der Verwaltung - The Politics Of Cultural Knowledge - Das Politische Im Literarischen Diskurs - Unternehmenscontrolling - Die Grundlagen Der Hochfrequenztechnik - Bindungsverlust Und Zukunftsangst Leben In Der Risikogesellschaft - Motive Und Weiterbildungsbedarf - Diagnose Und Therapie Der Gonorrhoischen Erkrankungen In Der Allgemeinpraxis - Corporate E-learning - Wirtschaftswrterbuch Dictionnaire ‰conomique - Endosonography In Obstetrics And Gynecology - Polymer Rheology - Atome Molekle Kerne - Sozialer Umbruch Und Kriminalitt In Deutschland - Der Arbeiternachwuchs In Der Deutschen Maschinenindustrie - Hrungsfrderndes Human Ressource Management - Die Inszenierung Des Neubeginns - Schienenverkehrstechnik - Akteure Beim Bodenschutz - Roloffmatek Maschinenelemente - Neuere Erfahrungen Ber Die Behandlung Und Beseitigung Der Gewerblichen Abwsser - Weltordnungspolitik - Pdagogik Und Ethik - Politikwissenschaft - Gesellschaft Technik Politik - Historische Frauen - Die Paranoia - Journalismusjournalismus - Amerikas Eindringen In Das Europische Wirtschaftsgebiet - Rolle Status Erwartungen Und Soziale Gruppe - Grundversuche Der Physik In Historischer Darstellung - Die Dampfturbine Im Betriebe - Ostdeutschland - Ertrgnisse Deutscher Aktiengesellschaften Vor Und Nach Dem Kriege - Schwangerschaft Als Krise - Bericht Ber Die 4 Sachverstndigen-konferenz Des Deutschen Vereins Zur Sorge Jugendliche Psychopathen Ev - Beginning Android 4 Games Development - Grundlagen Der Elektronik - Parteiendemokratie In Deutschland - Mnnlichkeiten Gemeinschaften Nationen - Deutsche Waschmittelfabrikation - Der Deutsche Bundestag - Reiseziel Frankreich - Plasmaphysik Und Fusionsforschung - Die Verwaltung Der Eisenbahnen - Die Eisenbahn Im Wirtschaftsleben - Betriebswirtschaftliche Kostenlehre - Nachhaltige Entwicklung In Industrie- Und Bergbauregionen Eine Chance Den Sdraum Leipzig - Friseurfachrechnen - Clays In Crustal Environments - Ambivalenz - Thermoreception And Temperature Regulation - Wege Aus Der Partnergewalt - Zur Rolle Des Vorwissens Beim Verstehen Literarischer Texte - Reden Die Die Republik Bewegten - Baubetriebspraxis - Akzeptanz Standardisierter Dienstleistungsvertrge - Lehrbuch Der Speziellen Pathologie Und Therapie Der Inneren Krankheiten Studierende Und „rzte 1-30 Aufl Leipzig Fcw - Die Renaissance Der Privatbankiers - Mittel- Und Langfristige Exportfinanzierung - The Nuclear Environmentalist - Geschlechterverhltnisse Geschlechterpolitik Und Gleichstellungspolitik In Der Europischen Union - Gehirnkrankheiten - Assembler Griffbereit - Bausteinbasierte Software - Ausgrenzung Macht Krank - Kostenrechnung 1 - Humangenetische Beratung - Einwanderungsdiskurse - Leitfaden Der Deutschen Sozialversicherung - Allgemeine Chirurgie Vorgetragen In Frage Und Antwort Nebst Einigen Kapiteln Ber Frakturen Luxationen Und Hernien - Einhrung In Die Baustatik - Output Measurements For Medical Ultrasound - Die Staatengesellschaft Im Globalisierungsprozess - Die Bestimmung Der Wasserstoffionenkonzentration Von Flssigkeiten - Spd Und Grne - First Class - Grundriy Der Unfallneurologie - Lehrbuch Der Forstwissenschaft - Programmieren Mit Modula-2 - Intellektuelle Und Sozialdemokratie - Rollenspiel Als Forschungsmethode - Migration Im Wettbewerbsstaat - Blockade Und Chirurgie Des Sympathicus - Erkenntnis Konstruktivismus Systemtheorie - A Longitudinal Study Of Adolescent Growth - Stabtragwerke Matrizenmethoden Der Statik Und Dynamik - Die Patentrecherche - Dtp-praxis Mit Pagemaker 5 - Das Bleichen Der Pflanzenfasern - Strategic International Marketing - Nation Und Modernitt Als Mythen - Browirtschaft - Jugendliche In Ffentlichen Rumen Der Stadt - Die Parkinsonsche Krankheit Und Ihre Behandlung - Programmieren Mit C - Perspektiven Mobiler Kommunikation - Implicit Incentives In International Joint Ventures - Arbeitsphysiologie Ii Orientierung Plastizitt Stimme Und Sprache - Praktische Mathematik - Krper • Geschlecht • Affekt - Neuroblastoma - „sie Wollen Mir Doch Was Verkaufen! - Lehrbuch Der Astronomie - Ernst Mach - Staat Und Glck - Bildung Im Ritual - Einfach Mehr Umsatz - Controversy In Cardiology - Architektur Zeichnen - Handwrterbuch Internationale Politik - „mit Nfzehn Hat Es Noch Trume … - Die Stationre Psychotherapie Und Ihr Rahmen - Die ‚erbpolizei‛ Im Nationalsozialismus - Gasentladungs- Tabellen - Ethical Issues Of Molecular Genetics In Psychiatry - Optimierungsmethoden Des Operations Research - Steueroasen - Chemie Und Struktur Der Pflanzen-zellmembran - Der Mensch Und Die Zeit - Modell Zur Bewertung Wohnwirtschaftlicher Immobilien-portfolios Unter Beachtung Des Risikos - Pro Spring 3 - Tauchen Mit Mischgas - Metaphysik Skepsis Wissenschaft - Methods Of Protein And Nucleic Acid Research - John Charnley - Selbst-pr Verkufer - Wissenschaftliches Arbeiten In Den Wirtschafts- Und Sozialwissenschaften - Tokolyse Und Betamimetika - Die Hartzerkleinerung - Gewichtung In Der Umfragepraxis - Heterogene Gleichgewichte - Management Der Organisation - Aktiv Und Konsequent Hren - Explosion Pipes - Politik Und Wirtschaft - Internationales Steuerrecht - Externe Berater Erfolgreich Einsetzen - Siebenstellige Tafeln Der Elementaren Transzendenten Funktionen - Lehrbuch Der Maschinendynamik - Umwelteinstellungen Und Umweltverhalten In Deutschland - Meytechnik An Maschinen Und Anlagen - Coal-bearing Depositional Systems - Interessenvermittlung Zwischen Konkurrenz Und Konkordanz - Macht Und Einfluss - Funktionelle Elektrostimulation - Cooperative Phenomena - Mittelstandsanleihen - Das Wagenbereinkommen Des Vereins Deutscher Eisenbahnverwaltungen Und Seine Wirthschaftliche Bedeutung - Vom Wohlfahrtsstaat Zum Wettbewerbsstaat - Pro Windows Phone App Development - Der Frauenstudiengang In Wilhelmshaven - Normativitt In Der Kommunikationswissenschaft - Elites In Transition - Kosten-nutzen-analyse Von Beruflicher Weiterbildung - Klinische Konstitutionslehre - Ehrenamt Und Brgerschaftliches Engagement Im Recht Ein Ratgeber - Lebenslagen Im Strukturwandel Des Alters - Nonlinear Dynamical Economics And Chaotic Motion - Gewerbliche Vergiftungen - Wirtschaftswachstum Strukturwandel Und Dynamischer Wettbewerb - Ddr-jugend - Sicher Auftreten Im Technischen Vertrieb - Die Rationelle Auswertung Der Kohlen Als Grundlage Die Entwicklung Der Nationalen Industrie - Distributed Information Systems In Business - Journalistische Ethik - Drahtlose Telegraphie Und Telephonie - Neue Entwicklungen In Der Therapie Von Lebertumoren - Pathophysiology And Pharmacology Of Erythropoietin - Lsungsheft Grundbildung Kaufleute - Die Wissenschaftlichen Grundlagen Der Elektrotechnik - Das Buerger-syndrom Thrombangiitis Obliterans - Umweltschutz Als Sozialer Prozey - Auf Kurs Gebracht - Jugend In Arbeit - Das Eigene Leben Leben - The Mathematical Foundation Of Structural Mechanics - Aktuelle Medientrends In Den Usa - Kinder Zu Welchem Preis - Gemeinschaftsformen In Der Modernen Stadt - Sprachkompetenz Tageszeitungsnutzung Und Politikorientierung Von Einwanderern - Jenseits Der Flucht - Heilen Forschen Interaktion - Bilanz Mit Aussichten - Acoustics Of Solids - Logic And The Organization Of Information - Berechnung Von Drehstrom-kraftbertragungen - Vitalitt S Unternehmen - Strategic Retail Management - Umweltpolitik - Gabler Kompakt Lexikon Umwelt- Undwirtschaftspolitik - Das Veranschlagen Von Hochbauten Nach Der Dienstanweisung Die Lokalbaubeamten Der Staats-hochbauverwaltung Einschlieylich Der Neuesten Vorschriften Das Garnisonbauwesen Sowie Die Normen Die Fabrikation Und Lieferung Von Baumaterialien Und Die Baupreise - Evaluation Von Studium Und Lehre - Berufsziel Journalismus - Pr-ausbildung In Deutschland - Dynamics Of Multibody Systems - Die Entstehung Der Gesteine - Suggestion And Suggestibility - Die Nfte Gewalt - Systemtheorien Im Vergleich - Appretur Der Textilien - Bildlexikon Der Dermatologie - Energietaschenbuch - Die Preuyischen Apothekengesetze - Physics Of Active Galactic Nuclei - Turbo-pascal In Beispielen - Dekorp-atlas - Behandlung Der Verletzungen Und Eiterungen An Fingern Und Hand - Herz Und Kreislauf - Medienentwicklung Und Gesellschaftlicher Wandel - Die Chromlederfabrikation - Renal Cell Carcinoma - Advances In Superconductivity V - Markenmanagement In Der Motorradindustrie - Die Maske Der Scham - Sozialstruktur Im Umbruch - Migrationsforschung Als Kritik - Traditionales Denken Und Modernisierung - Uro-sonographie - Fertigungsverfahren Der Mechatronik Feinwerk- Und Przisionsgertetechnik - Wahlen Und Wahlkampf In Den Medien - Images In Mobile Communication - X-ray Microscopy And Spectromicroscopy - Innovations In Abdominal Ultrasound - Elektrodynamik - Theoretische Meteorologie - Der "ossi" - Wrterbuch Der Datentechnik Dictionary Of Computing - Design For Innovative Value Towards A Sustainable Society - Gegekunde Der Gesteine - Die Wassermannsche Reaktion In Ihrer Serologischen Technik Und Klinischen Bedeutung Auf Grund Von Untersuchungen Und Erfahrungen In Der Chirurgie - Sport Und Krperliche Aktivitt In Der Onkologie - Die Liberale Nation - Ethnizitt Islam Reformasi - Hilfsbuch Raum- Und Auyenklimatische Messungen Hygienische Gesundheitstechnische Und Arbeitsmedizinische Zwecke - Gefhrdete Jugendliche - Post-lesion Neural Plasticity - Dissipative Structures And Chaos - Internationale Anlagengeschfte - Business Ethics - Verfassungsgebung Und Systemwechsel - Innovation Macht Schule - Grundzge Der Brillenlehre Augenrzte - Viskoelastika Eine œbersicht - Flow Visualization Vi - Materialflusstechnik - Strahlen Und Strahlenschutz - Die Entstehung Der Knotentheorie - Vereintes Deutschland Geteilte Jugend - Die Geschichtliche Entwicklung Der Hochspannungs-schalttechnik - Algebraische Strukturen - Die Krankheiten Des Kaninchens - Aussage Gegen Aussage In Sexuellen Missbrauchsverfahren - Jugendliche Angestellte - Frieden Und Konflikt - Der Mathematikunterricht In Der Primarstufe - Ganzheitliches Management - Regionalentwicklung In Der Kommunikationsgesellschaft - Interdisciplinary Applications Of Kinematics - Griechische Staatsaltertmer - Die Medicinischen Verbandmaterialien Mit Besonderer Bercksichtigung Ihrer Gewinnung Fabrikation Untersuchung Und Werthbestimmung Sowie Ihrer Aufbewahrung Und Verpackung - Amphetamin In Der Klinischen Medizin - Das Integrationspotential Des Internet Migranten - Erfolg Durch Resonanz - Physics For A New Generation - Die Kunst Der Innovation - Das Gestaltproblem - Geschftspartner S Leben - Allgemeine Therapie Der Hautkrankheiten - Die Gesellschaftliche „natur Der Technik - Grundfragen Deutscher Wirtschaftspolitik - Current Problems In Ptca - Unvergessene Diskurse - Erwachsenenbildung In Politischen Umbrchen - Der Haushaltsausschuy Des Deutschen Bundestages - Human Growth Hormone - Handbuch Die Bekleidungsindustrie Und Den Bekleidungs-einzelhandel - Bauauftrge Erfolgreich Akquirieren - Bibliographie Der Gesamten Gynaekologie Und Geburtshilfe Sowie Deren Grenzgebiete Das Jahr 1913 - Technological Change In A Spatial Context - Engagement Die Erwachsenenbildung - Grundriss Der Botanik - Erfolgreich Gegen Kopfschmerzen Und Migrne - Grundriy Der Wildbachverbauung - Lnder-parlamentarismus In Deutschland - Staat Und Politische Bildung - Audiovisuelle Medienberufe - Die Unfall- Und Gesundheitsgefahren In Der Steinkohlenteerdestillation Nebst Einigen Vorschlgen Zu Ihrer Bekmpfung - Strategisches Management - A Gift Of Life - The Design Productivity Debate - Migration Gesellschaftliche Differenzierung Und Bildung - Soziale Gerontologie Und Sozialpolitik Ltere Menschen - Funktionentheorie Differentialtopologie Und Singularitten - Blood Supply Of Bone - Kinder- Und Jugendhilfe In Der Schweiz - Kommunikationsanschlsse - Corporate Citizenship - Lees Ophthalmic Histopathology - Developing Business Application Systems - Konfliktfeld Natur - Die Exportmglichkeiten Der Deutschen Maschinenindustrie - Prfungsvorbereitung Industriekaufleute - Produktion Als Wettbewerbsfaktor - Atlas Anatomischer Varianten Des Schdels Im Rntgenbild - Advances In Fluid Mechanics And Turbomachinery - Klinik Und Atlas Der Chronischen Krankheiten Des Zentralnervensystems - Dictionnaire ‰conomique Wirtschaftswrterbuch - Electronic Business Und Mobile Business - From Ca To Cas Online - Zehnkampf-power Manager - Grundbegriffe Des Stdtebaues - Der Schlaf Seine Strungen Und Deren Behandlung - Magnetic Resonance Imaging Of Central Nervous System Diseases - Eeg Atlas For Anesthesiologists - Rationelle Diagnostik Und Therapie Bei Koronarer Herzerkrankung - Demokratisierung Von Organisationen - Cg International 90 - Chemische Ingenieur-technik - A Primer Of Neuroimmunological Disease - Diskriminierung - Antiarrhythmic Drugs - Nahost Jahrbuch 2000 - Die Wohlfahrtsverbnde Im Ns-staat - Oestrogene Beim Menschen - Cytology In Gynecological Practice Gynkologische Vitalzytologie In Der Praxis - Existential-phenomenological Perspectives In Psychology - Einwandererverbnde In Der Migrations- Und Integrationspolitik 1998-2006 - Investment Fonds - Die Durchlssigkeit Der Haut Arzneien Und Gifte - Algebra Aller Anfang Ist Leicht - Bevlkerungsfragen Auf Abwegen Der Wissenschaften - Kommunikationswissenschaft Studieren - Soziale Kommunikation - Leitfaden Das Maschinenzeichnen - Industrialisierung Der Kreditwirtschaft - Computed Tomography And Magnetic Resonance Tomography Of Intracranial Tumors - Das Siebte Buch Objektorientierung Mit C++ - Cause Related Marketing - Kritik Als Qualittskriterium Pdagogischen Handelns - Chaos Und Systeme - Kinder Und Der Medienmarkt Der 90er Jahre - Sozialismus Und Soziologie - Wissensmanagement Die Veranstaltungsbranche - Quo Vadis Ct - Nahost Jahrbuch 1991 - Berechnung Der Kltemaschinen Auf Grund Der Entropie-diagramme - Telefonmarketing - Dermatologie - Mit Dem Krper Sprechen - The European Oil And Gas Conference - Pascal Wirtschaftswissenschaftler - Peripherisierung Stigmatisierung Abhngigkeit - Compressive Optic Nerve Lesions At The Optic Canal - Wissensspeicher Tribotechnik - Die Synthese Von Einheitlichen Polymeren - Ambulantes Operieren Der Neue Weg In Der Gynkologie - Leukemias - Lehrbuch Der Geburtshilfe - Einhrung In Die Lehre Von Der Wrmebertragung - Verkauf Von Versicherungen Und Finanzdienstleistungen Ist Keine Magie - Die Rntgendiagnostik Der Intrathorakalen Tumoren Und Ihre Differentialdiagnose - Lernplattformen In Schulen - Mobilfunknetze - Fundamentals Of Cosmic Particle Physics - Natrliche Und Pflanzliche Baustoffe - Vieweg Taschenlexikon Technik - Automatic Algorithm Selection For Complex Simulation Problems - Bericht Ber Die Xxii Tagung Kriegstagung - Kreiselrder Als Pumpen Und Turbinen - Wandel Von Der Telekommunikation Zu Unified Communications - Ethnizitt Und Raum Im Aufstiegsprozey - Biology Of Antarctic Fish - Ddr Und Osteuropa - Auge Brille Auto - Einhrung In Die Synoptische Wetteranalyse - Asbestzement - Der Wandel Des Franzsischen Parteiensystems - Framework Iii - Soziale Investitionen - Reproductive Biology And Plant Breeding - Fremde · Freunde · Feindlichkeiten - Spanende Werkzeugmaschinen - Joint Surgery Up To Date - Wissenssoziologie Sozialer Probleme - Az Handbuch Asbestzementrohre - Heidelberger Gelehrtenlexikon - Beginning Windows Phone App Development - Grundzge Der Zerspanungslehre - Abstimmungskampagnen - Die Zeitung Zwischen Print Und Digitalisierung - Grundlagen Der Erforschenden Statistik - Die Theorie Der Gewichtsstaumauern Unter Rcksicht Auf Die Neueren Ergebnisse Der Festigkeitslehre - Klima Und Gradtage In Ihren Beziehungen Zur Heiz- Und Lftungstechnik - Armut Gerechtigkeit Und Soziale Grundsicherung - Die Malaria - Volume 1 Mechanisms Of Inorganic And Organometallic Reactions - Zentralabitur - Metabolic Turnover In The Nervous System - Einhrung In Das Einheitliche Wechselrecht - Handbuch Der Astrofotografie - Beton Anregungen Zur Verbesserung Des Materials - Die Methode Der Tauschwerthe - Die Zerbrochene Wirklichkeit - Die Kretinische Entartung - Die Lehre Vom Raumsinn Des Auges - Kochlehrbuch Und Praktisches Kochbuch - Politikwissenschaft In Deutschland - Signale Und Systeme Verstehen Und Vertiefen - „aneignung Als Bildungskonzept Der Sozialpdagogik - Scheduling In Computer And Manufacturing Systems - Therapeutic Hemorheology - James Watt Und Die Grundlagen Des Modernen Dampfmaschinenbaues - Geschichte Der Nachrichtentechnik - Medikamentse Behandlung Des Postinfarktpatienten Nach Cast - Beweissicherung Im Bauwesen - The Knee And The Cruciate Ligaments - Fuzzy Computational Ontologies In Contexts - Zeit Und Kultur - Fachkommentar Bm„e-go - Hochbau Konstruktion - Jugend Und Wohnen - Fit For Business - Aktuelle Probleme Der Nephrologie - Einhrung In Die Finanz- Und Wirtschaftsmathematik - Wenn Aus Liebe Rote Zahlen Werden - Kurze Chirurgische Operationslehre - Springer-taschenbuch Der Mathematik - Simulation Neuronaler Netze - Auf Dem Wege Zu Einer Anthropologischen Psychiatrie - Wieder Den Konomischen Unsinn! - Human Quality Management - Institutionalisierung Psychosozialer Versorgung - 85 Jahre Universittsklinik Dermatologie Und Venerologie Zrich 19162001 - Atlas Der Positronen-emissions-tomographie Des Gehirns Atlas Of Positron Emission Tomography Of The Brain - Ethics In Reproductive Medicine - Thermodynamics For Chemists Physicists And Engineers - Kinder Auf Der Flucht - Eingriffverhltnisse Der Schneckengetriebe Mit Evolventen- Und Cykloidenverzahnung Und Ihr Einfluss Auf Die Lebensdauer Der Triebwerke - Mediastinale Sonographie - Spinal Cord Stimulation Ii - Einhrung Wirtschaftsinformatik - E-coaching Und Online-beratung - Aroma Biotechnology - Bildung In Frankreich - Der „hugenberg-konzern - Biofouling Bei Membranprozessen - Angiography Of The Human Brain Cortex - Familientraditionen Und Familienkulturen - Die Dampfkessel Und Ihr Betrieb - Wege Aus Der Krise - Migration Aus Afrika In Die Eu - Aktiv Und Gesund - Machining Of Complex Sculptured Surfaces - Investition Finanzierung Und Besteuerung - Recent Advances In Coronary Circulation - Die Dampfturbinen - Die Stille Macht - Kompetenz Zur Hrung - Soziale Stadtentwicklung - Der Feldversuch In Der Praxis - Handbuch Spezielle Soziologien - Frankreich Europa Weltpolitik - Epidemiology And Management Of Root Diseases - Handbuch Der Physik - Gesenkschmiede - Israel Gesellschaft Im Wandel - Rubber Technology - Sozialmanagement - Metallurgische Technologie - Physicochemical Aspects Of Polymer Surfaces - Imaging Anatomy Of The Knee Region - Problemkreis Altlasten - Aus Der Chirurgischen Praxis - Nherungsversuche Jugend 81 - Stdtischer Raum Und Verhalten - Hemocoagulative Problems In The Critically Ill Patient - Marken-power - Die Natrliche Und Knstliche Alterung Des Gehrteten Stahles - Medizinische Psychologie „rzte Und Psychologen - Aktuelle Therapie Des Kardiakarzinoms - Milde Hypertonie Und Leichte Fettstoffwechselstrungen - Fahrdynamik Des Schienenverkehrs - Die Prfung Der Textilien - Party-voter Linkage In Africa - Problemlsekompetenz Von Schlerinnen Und Schlern - Endoprothetik - Kriminalitt Und Sicherheitspolitik - New Directions Of Oceanographic Research And Development - Salben · Puder · Externa - Lineare Algebra Und Analytische Geometrie I - Haushalte Ohne Auto - Globales Lernen Und Lokale Agenda 21 - Wie Die Medien Die Welt Erschaffen Und Wie Die Menschen Darin Leben - Management Komplexer Familienvermgen - Voices Of Resilience - Gyrodynamics - Grne Parteien In Westeuropa - Design For Environment As A Tool For The Development Of A Sustainable Supply Chain - Plant Genome Diversity Volume 1 - Die Mikroskopische Untersuchung Der Seide Mit Besonderer Bercksichtigung Der Erzeugnisse Der Kunstseidenindustrie - Der Neue Verkaufsmanager - Maschinenbau Elektrotechniker - Arbeitsrechtliche Gesetze - Messen Steuern Und Regeln Mit Iconnect - Vertrauen Und Wissen In Governance-prozessen - Quantitative Methoden In Den Wirtschaftswissenschaften - Die Anfangsstadien Der Wichtigsten Geisteskrankheiten - Das Recht Der Brsen - Wege Zur Hochschulreife In Baden-wrttemberg - Partnerwahl Im Internet - Natur Wissenschaft Und Ganzheit - Lehrbuch Der Physiologischen Chemie - Stresses In Shells - Advances In Genetics Development And Evolution Of Drosophila - Altersvorsorge 2012 - Wohlfahrtsstaat Einwanderung Und Ethnische Minderheiten - Lan Praxis Lokaler Netze - Logistik Und Qualittsmanagement Im Gesundheitsbetrieb - Soziales Deutschland - Psychologie Sozialer Prozesse - Internationale Kommunikation - Convection In Liquids - Aseismischer Anlagenbau - Klteprozesse - Die Kathodenstrahlrhre Und Ihre Anwendung In Der Schwachstromtechnik - Wirksame Und Unwirksame Klauseln Im Vob-vertrag - Cerebral Ischemia And Dementia - Bilanzierung Von Finanzinstrumenten - Variations And Connections Of The Human Thalamus - „rztliches Handbchlein Hygienisch-ditetische Hydrotherapeutische Mechanische Und Andere Verordnungen - 100 Minuten Konstruktive Teamarbeit - Distributed Environments - Mathematica Vom Problem Zum Programm - Planung Und Reporting Im Mittelstand - Einhrung In Die Spieltheorie - Sexualitt Miybrauch Gewalt - Conditio Humana - Perspektiven Der Telekommunikationspolitik - Intersections Without Traffic Signals Ii - Speicheldrsenerkrankungen - Derivative Finanzinstrumente - Asbest Und Lunge - Empirische Sozialforschung Und Gesellschaftliche Praxis - Haarkrankheiten Und Kosmetische Hautleiden - Soziale Lagen Im œbergang - Electromagnetic Field Theory - Wohlfahrtspolitik Und Globalisierung - Deutschland-trendbuch - Therapie Des Harnblasenkarzinoms - Praxis Der Mikrophotographie - Chancen Die Erwerbsarbeit Im Alter - The Macula - Neuronale Netze In Der Finanzwirtschaft - Forensische Psychopathologie - Kommunikation Und Verstndigung - Das ‚bessere Geld - Soziale Und Gesellschaftliche Differenzierung - Das Soziale Als Ritual - Gewaltpotentiale Des Fernsehangebots - Entwickelungsgeschichtliche Untersuchung Ber Crenothrix Polyspora Die Ursache Der Berliner Wassercalamitt - Gesprchsanalyse Und Dokumentarische Methode - Chirurgische Intensivmedizin - Angewandte Elektrizittslehre - On The Movement Of Animals - Atlas Of Muscle Innervation Zones - Krfte In Bewegung - Lehrbuch Der Militrhygiene - Soziale Rationalitt - Regionalisierung Der Strukturpolitik In Nordrhein-westfalen - An Den Rndern Der Deutschen Hauptstadt - Die Abderhaldensche Reaktion - Grundfragen Der Theorie Politischer Institutionen - Cultural Studies Und Pop - Technik Und Demokratie - Die Kpenfarbstoffe Und Ihre Verwendung In Der Frberei Und Im Zeugdruck - Identifikation Loyalitt Und Kooperation - Die Vorkalkulation Im Maschinen- Und Elektromotorenbau Nach Neuzeitlich-wissenschaftlichen Grundlagen - Helicobacter Pylori And Gastroduodenal Pathology - Der Praktische Einsatz Von Datenverarbeitungssystemen - Erfahrung Und System - Europas Tchter - Clinical Pharmacology Of Anti-epileptic Drugs - Klingelnberg Technisches Hilfsbuch - Hren In Schwierigen Zeiten - Die Kunst Der Unterredung - Stahlbetonbau Nach Ec 2 - Computergesttzte Netzplantechnik - Aktienanalyse Heute - Nutrition And Behavior - Handbuch Werbeforschung - Analyse Und Simulation Elektronischer Schaltungen - Die Vertriebs-offensive - Konstruktion Und Berechnung Von Selbstanlassern Elektrische Aufzge Mit Druckknopfsteuerung - Die Anwendung Hoher Ueberhitzung Beim Betrieb Von Dampfturbinen - Das Elektrostahlverfahren - Geology Of Holocene Barrier Island Systems - Wrmediagramme Vergasung Verbrennung Und Ruybildung - Tragwerkslehre - Die Bewegungsgruppe Einer Euklidischen Ebene - Isse 2011 Securing Electronic Business Processes - Liniendiagramme In Der Wissenskommunikation - Fabrikschulen - Die Operative Technik Des Tierexperimentes - Optimierung Von Deponieabdichtungssystemen - Management Von Spitzenqualitt - Morphologische Bildverarbeitung - Die Bedeutung Von Morphemen Die Sprachanalyse - Solvomercuration Demercuration Reactions In Organic Synthesis - Botanisch-geologische Spaziergnge In Der Umgegend Von Berlin - Personalbeurteilung - Sozialwissenschaftliche Datenanalyse Mit R - Starthilfe Thermodynamik - Die Maschinenzlle In Den Wichtigsten Kulturstaaten Der Welt Nach Dem Stande Vom 1 Januar 1908 - Peptides As Probes In Muscle Research - Planungslexikon - Anweisung Die Planung Aushrung Und Unterhaltung Von Drnanlagen - Ausgewhlte Schriften - Thoraxtumoren - Deutschland Nach Den Wahlen - Die Schleifmaschine In Der Metallbearbeitung - Die Prfung Und Die Eigenschaften Der Kalksandsteine - Komplexittsmanagement - Non-fibrillar Amyloidogenic Protein Assemblies - Common Cytotoxins Underlying Degenerative Diseases - Reformen Jetzt! - Migration Und Nationaler Wohlfahrtsstaat - Gewaltspiralen - Wrterbuch Zur Mikropolitik - Experimental Cardiovascular Diseases - Advances In Ct Iii - Die Analyse Der Milch Und Milcherzeugnisse - Lehrbuch Der Hals- Nasen- Und Ohrenkrankheiten - Handbuch Methoden Der Empirischen Sozialforschung - Glubiger Schuldner Arme - Soziale Arbeit Als Wissenschaft - Miscellanea Mathematica - Abschied Von Der Aufklrung - 3d Geoscience Modeling - Vascular Diagnostics - Krieg Gegen Die –ffentlichkeit - Die Integrationsfunktion Der Massenmedien - Helicobacter Pylori Gastritis And Peptic Ulcer - Lehrbuch Der Metallkunde Des Eisens Und Der Nichteisenmetalle - Primary And Secondary Metabolism Of Plant Cell Cultures Ii - Grundzge Der Wissenschaftlichen Elektrochemie Auf Experimenteller Basis - Interfaces Und Datennetze - Ethnologie Anfnger - Der Lichtelektrische Effekt Und Seine Anwendungen - Qualittsmanagement In Non-profit-organisationen - Das Tonwerk Im Rechtssinne - Coronary-prone Behavior - Medizinmanagement - Der Verkauf Elektrischer Arbeit - Lohmeyer Baustatik 2 - Unternehmen In Der Kologischen Diskussion - Neuordnung Oder Restauration - Der Kampf Um Das Sozialistengesetz 1878 - Die Ernhrung Des Menschen Mit Besonderer Bercksicht Gung Der Ernhrung Bei Leibesbungen - Urologische Beckenchirurgie - Herrschaft In Der Modernen Gesellschaft - Professionalitt - Practical Knowledge-based Systems In Conceptual Design - Basic-wegweiser Ibm Personal Computer Und Kompatible - Das Patellofemoralgelenk Beim Knstlichen Kniegelenkersatz - Klinische Rntgendiagnostik Des Verdauungskanals - Light Scattering In Solids - Capillary Electrophoresis - Fderalismus An Der Wegscheide - Pdagogik Als Vergleichende Kulturwissenschaft - Entwicklungspsychiatrie Des Kindes - Geschichtsunterricht Im Demokratischen Staat - Haustechnik - Wahrscheinlichkeitsrechnung Und Statistik In Beispielen Und Aufgaben - Interviews In Der Recherche - Dense Gases For Extraction And Refining - Wirtschaftsprfung - Ein Deutscher Ombudsman - Z-transformation Ingenieure - Der Nahrungsmittelchemiker Als Sachverstndiger - Die Apotheken-gesetzgebung Des Deutschen Reiches Und Der Einzelstaaten Auf Der Grundlage Der Allgemeinen Politischen Handels- Und Gewerbegesetzgebung Dargestellt - Einhrung In Die Mechanik Akustik Und Wrmelehre - Pulstechnik - Aufgaben Der Eisenbahn - Politik - Intelligent Software Agents - Pdagogische Permissivitt - Therapeutic Antibodies - Jugend Rechtsextremismus Und Gewalt - Europische Unternehmensbesteuerung - Sql Mit Oracle - Gesellschaftliche Bedeutung Von Kirchenrumen - Marken Erleben Im Digitalen Zeitalter - Finanzierung Der Betriebe - Ditetik Innerer Erkrankungen - Offene Systeme - Bauen Im Bergbaugebiet - Sexualisierte Gewalt - Boundary Integral Methods - Benachteiligte Jugendliche In Europa - Die Universitt Heidelberg Und Die Geburt Der Modernen Wissenschaft - Das Praktische Jahr In Der Maschinen- Und Elektromaschinenfabrik - Natural Products Chemistry Iii - Die Textilfasern - Die Hypertoniekrankheiten - Die Psychologie Des Menschen Im Flugzeug - Comparative Embryology Of Angiosperms Vol 12 - Nichtlineare Optimierung - Unterricht Und Didaktik Der Politischen Bildung In Der Bundesrepublik - Umweltberichterstattung Im Lokalen - –ffentlichkeit Und Vertraulichkeit - Informations- Und Wissensverarbeitung In Den Sozialwissenschaften - Der Lange Weg Zur Erfolgsmannschaft - Konsum - Zukunft Von Stadt Und Region - Grundriy Der Verfassung Und Verwaltung In Preuyen Und Dem Deutschen Reiche - Scheitern - Medizinische Karikaturen Von 1800 Bis Zur Gegenwart - Der Jugoslawien-krieg - Zur Aktualitt Von Jean Baudrillard - Elektrotechnik Architekten Bauingenieure Und Gebudetechniker - Minderjhrige Flchtlinge - Unbestimmte Transzendenz - Performance Based Logistics - Print Medium Mit Zukunft - Creativity For 21st Century Skills - Privatschulen Versus Staatliche Schulen - Kurze Geschichte Der Katalyse In Praxis Und Theorie - Photonic Packaging Sourcebook - 55plus Marketing - Membrane Bioenergetics - Elektro-fachrechnen 1 - Erfolgsfaktor Markenname - Beyond Elder Law - Solarzellen - Dbase Iv - Das Strayenkinderprojekt Als Organisation - Kommunitarismus - Die Elektrische Beleuchtung Von Eisenbahnfahrzeugen - Handbuch Militrische Berufsethik - Fuchs-aktuell Vermgensmanagement Mit Etfs - Molekularakustik - Biofouling And Biocorrosion In Industrial Water Systems - Industrial Crystallization - Gewhnliche Und Operator-differentialgleichungen - Balanceakt Alleinerziehend - Grundlagen Des Beton- Und Eisenbetonbaues - Oxidative Injury In Dermatopathology - Makrokonomik - Lehrbuch Der Organischen Chemie - Drying Of Polymeric And Solid Materials - Das Pc-wissen It-berufe Hardware Betriebssysteme Netzwerktechnik - Erwerbsbiographien Und Materielle Lebenssituation Im Alter - Mythos Determinismus - Die Meistbegnstigung Im Modernen Vlkerrecht - Rutschungen Und Ihre Sanierung - Stahlbau Und Baustatik - Early Pregnancy Loss - Die Lehre Neu Verstehen Die Wissenschaft Neu Denken - Die Tuberkulose Und Ihre Bekmpfung Durch Die Schule - Wrter In Der Politik - Termersetzungssysteme - General G©rard Und Die Pfalz - Die Gichtgas-reinigung - "ihre Werte Bitte!" - Trace Elements In Clinical Medicine - Die Synchronen Wechselstrommaschinen Generatoren Motoren Und Umformer Ihre Theorie Konstruktion Berechnung Und Arbeitsweise - Die Liberalen Parteien Angesichts Der Zukunft Preuyens - Neue Graphische Tafeln Zur Beurteilung Statistischer Zahlen - Festivalisierung Der Stadtpolitik - Forschung Mit Rntgenstrahlen - Die Theorie Der Beobachtungsfehler Und Die Methode Der Kleinsten Quadrate Mit Ihrer Anwendung Auf Die Geodsie Und Die Wassermessungen - How Should Elderly Hypertensive Patients Be Treated - Linguistische Datenverarbeitung - Parteien In Frankreich - Praxishandbuch Immobilieninvestments - Fractures Of The Acetabulum - Der Betriebskoeffizient Der Eisenbahnen Und Seine Abhngigkeit Von Der Wirtschaftskonjunktur - Funktionsdiagnostik Des Linken Ventrikels Mittels Zweidimensionaler Echokardiographie - Das Problem Der Industriearbeit - Alterations Of Chemical Equilibrium In The Nervous System - Frickknll Baukonstruktionslehre 2 - Die Modernisierung Der Stromversorgung - Die Gestrte Regelung Der Ovarialfunktion - Principles Of Fluorescence Spectroscopy - Transformation In Ungarn Und Der Ddr - Erfolgsausweis Deutscher Aktienkonzerne - Schtze Und Schtzensteuerungen - Medienwissenschaften Und Medienwertung - Die Licht-therapie - Aufgaben Zur Elektrotechnik Maschinenbauer - Law In The Making - Das Dividendenbezugsrecht Des Aktionrs - Software-prfung - Schlsselwerke Der Soziologie - Grundzge Der Botanik - Die Elliptischen Funktionen Von Jacobi - Die Praxis Der Hydrotherapie Und Verwandter Heilmethoden - Die Waldstreu Und Ihre Bedeutung Boden Und Wald - Stochastic Structural Dynamics 2 - Umweltbewusstsein Im Wandel - Bestnde-controlling - Nephrocalcinosis Calcium Antagonists And Kidney - Der Psychische Ursprung Des Lebens - Tragwerkslehre In Anschauungsmodellen - Software Engineering - Lexikon Der Elektronik - Die Wirkung Der Kundenloyalitt Im Vertikalen Wettbewerb - Kompendium Der Analysis - Ein Kompletter Bachelor-kurs Von Reellen Zahlen Zu Partiellen Differentialgleichungen - Die Konstruktionssthle Und Ihre Wrmebehandlung - Wer Ist Fremd - Luhmann Modelliert - Inside A Secret Software Laboratory - Die Asynchronmotoren Und Ihre Berechnung - Multisensuelle Unternehmenskommunikation - Advances In Microbial Ecology - Die Pathologische Physiologie Des Gesamtstoff- Und Kraftwechsels Bei Der Ernhrung Des Menschen - Handbuch Journalismustheorien - Der Kaffee - Dagstuhl-seminar 1997 - Software-metriken In Der Praxis - Human Development And Health - Die Physikalischen Grundlagen Der Elektrischen Festigkeitslehre - Primer Of Cancer Management - Justizberichterstattung - Kompendium Event-organisation - Vom Wert Der Wohlfahrt - Standards In Pancreatic Surgery - Politische Kommunikation In Der Demokratischen Gesellschaft - Enthalpie-entropie-diagramme Wasserdampf Und Wasser - Politik Und Regieren In Bayern - Langsamkeit Entdecken Turbulenzen Meistern - Die Mitte - Stiftungsvermgen - Die Besten Manager 2009 - Topspeed Modula-2 Von Az - Medienpolitische Strategien Das Interaktive Fernsehen - Regelung Der Kraftmaschinen - Eu-beitritt Verheiyung Oder Bedrohung - Experimental Studies On Guinea Pig Eczema - Sinnwelt Freizeit - Die Sprache Des Traumes - Lehmbau Regeln - Strategisches Controlling - Talsperren In Deutschland - Physik Und Technik Der Atomreaktoren - Die Lehre Vom Wirtschaftsbetrieb - Soziale Benachteiligung Und Gesundheit Bei Kindern Und Jugendlichen - Digitale Bildgebende Verfahren Interventionelle Verfahren Integrierte Digitale Radiologie - Die Influenzapsychosen Und Die Anlage Zu Infektionspsychosen - Chemisch-technische Untersuchungsmethoden - Redaktionsmanagement - Randwertprobleme Der Mikrowellenphysik - Mathematik Volks- Und Betriebswirte - Das Mathematica Arbeitsbuch - Betriebswirtschaft Architekten Und Bauingenieure - Schenken - Statical And Geomechanical Models - Lexikon Der Fertigungsleittechnik - Total Hip Arthroplasty - Meilensteine Der Frauen- Und Geschlechterforschung - Einhrung In Die Mechanik Mit Einfachen Beispielen Aus Der Flugtechnik - Modified Inferior Turbinoplasty - Wahlwerbung Als Politische Kultur - Prototyping - Zwei Drfer In Deutschland - Die Industrielle Keramik - Calcium Antagonists - Elementarteilchen - Herrschaftstheorien Und Herrschaftsphnomene - Regieren In Der Bundesrepublik Iv - Grundlagen Der Gynkologischen Ausbildung - Formeln Und Lehrstze Zum Gebrauche Der Elliptischen Functionen - Meteorologie Der Strahlstrme - Die Chemische Untersuchung Des Eisens - Wirtschaftliche Produktion „geistiger Gter In Einer Selbstbestimmten Erwerbswelt - Elementare Logik - Ditetik Der Stoffwechselkrankheiten - Taschenbuch Der Wasserwirtschaft - Progress In Pacific Polymer Science - Ethical Social Index Numbers - Fundamentals Of Digital Machine Computing - Aufwertung Der Erziehungsarbeit - Gabler Lexikon Recht In Der Wirtschaft - Klinische Rntgendiagnostik Der Erkrankungen Der Brustorgane - Die Macht Der Reprsentation - Die Stahlindustrie Der Vereinigten Staaten Von Amerika In Ihren Heutigen Produktions- Und Absatz-verhltnissen - 100 Rezepte Excel 50 - Dynamics During Spectroscopic Transitions - Neuroactivation And Neuroimaging With Spet - Bernhard Schwalbe Gedchtnisrede - Patterns Programming And Everything - Elektrische Gasentladungslampen - Biotechnology In Japan - Erfinden Und Konstruieren - Supervision Auf Dem Prfstand - Die Quellen - Marketingstrategien Rezeptfreie Arzneimittel - Stollen- Und Tunnelbau - Modernization Science - Dynamische Systeme Steuerbarkeit Und Chaotisches Verhalten - Atlas Of Atherosclerosis - L-dopa-substitution Der Parkinson-krankheit - Karriere Machen Der Weg In Die Unternehmensberatung - Staatsoberhupter In Westlichen Demokratien - Aushrung Potentiometrischer Analysen Nebst Vollstndigen Analysenvorschriften Technische Produkte - Einhrung In Die Kinderheilkunde - Beitrge Zur Entwicklungsgeschichte Der Kraniozerebralen Topographie Des Menschen - Nachhaltige Mobilitt In Europa - Bau Groyer Elektrizittswerke - Nutzungswandel Und Stdtebauliche Steuerung - Quaternary Period In Saudi Arabia - Die Neueren Wandlungen Der Elektrischen Theorien - Das Elektrokardiogramm - Grundriy Der Gesamten Praktischen Medizin - Schlsselwerke Die Kommunikationswissenschaft - Schwingungen - Computational Fluid Dynamics Based On The Unified Coordinates - Normal Ultrasound Anatomy Of The Musculoskeletal System - Anfangsgrnde Der Chemie - Der Kugeldruckversuch Nach Brinell Die Hrteprfung Mit Vorlast Und Die Hrteprfung Nach Vickers - Unternehmensbewertung Und Potentialanalyse - Physical Processes In Estuaries - Begabtenfrderung Im Gymnasium - Das Rechnungswesen Der Kartell- Und Gruppen-wirtschaft - Drogisten-lexikon Ein Lehr- Und Nachschlagebuch Drogisten Und Verwandte Berufe Chemotechniker Laboranten Groyhandel Und Industrie - Fermentation - Gehirn Und Auge - Kinderradiologie 1 - Selektion Im Internet - Radiographic Planning And Assessment Of Endosseous Oral Implants - Die Zweckmssigkeit In Der Entwicklungsgeschichte - Klaus Jrgen Maack Design Oder Die Kultur Des Angemessenen - Meygerte Und Schaltungen Wechselstrom-leistungsmessungen - Steuerrecht In Nonprofit-organisationen - Die Quarzlampe Und Ihre Medizinische Anwendung - Principles Of Statistical Radiophysics 3 - Zuverlssigkeits- Und Instandhaltungstheorie - œbungsbuch Ifrs - Berechnung Entwurf Und Betrieb Rationeller Kesselanlagen - Allgemeine Chirurgie - Der Moderne Dandy - Bttcherforberg Technisches Zeichnen - Grenzobjekte - Grenzen Der Herrschaft - Topics On Nonlinear Wave-plasma Interaction - Journalismus In Der Gesellschaft - Islam Ist Nicht Gleich Islam - Missbrauch Im Sozialstaat - Die Narkose - Parteisoldaten Und Rebellen - Internetnutzung Von Jugendlichen Einen Auslandsjugendaustausch - Lokales Sozialkapital Die „soziale Stadt - Die Rntgentechnik In Diagnostik Und Therapie - Nfstellige Tabellen Zu Den Elliptischen Funktionen Five Place Tables Of Elliptical Functions - The Rust Fungi Of Cereals Grasses And Bamboos - Differentialdiagnose Der Herztne Und Herzgerusche - Einhrung In Die Theoretische Physik - Grundfragen Des Mathematikunterrichts - Like It Lead It Change It Hrung Im Vernderungsprozess - Lern- Und Leistungsmotivation - Die Malariatherapie Der Syphilis - Charakteropathien Nach Frhkindlichen Hirnschden - Condition Monitoring Using Computational Intelligence Methods - The Machine As Metaphor And Tool - Zum Werk Leonhard Eulers - A Textbook Of Medical Practice - Gerechtigkeit Diskurs Oder Markt - Der Staat Der Autonomen Gemeinschaften In Spanien - Nuclear Imaging Of The Chest - Objektive Mglichkeit - Arrhythmiebehandlung Und Hmodynamik - Schwierige Machtverhltnisse - Medien Und –konomie - Vollmachten Im Unternehmen - Technische Schwingungslehre In Ihren Grundzgen - Die Physikalischen Und Chemischen Grundlagen Der Glasfabrikation - Neue Medien Im Alltag - Partnerschaften Von Ngos Und Unternehmen - Geschftsbereichsorganisation - Performativitt Und Medialitt Populrer Kulturen - Die Flexible Supervision - Technik Aus Soziologischer Perspektive 2 - 11 Irrtmer Ber Social Media - Internationale Kooperationen Und Joint Ventures - Jahrbuch Psychodrama Psychosoziale Praxis And Gesellschaftspolitik 1993 - Die Geteilte Utopie Sozialisten In Frankreich Und Deutschland - Die Grundstrukturen Einer Physikalischen Theorie - Hacker Cracker Datenruber - State-of-the-art In Computer Animation - Bilanzpolitik Und Kreditvergabeentscheidungen - Komplexe Strukturen Entropie Und Information - Die Verfahren Der Plastischen Berechnung Biegesteifer Stahlstabwerke - In Der Schule - Das Skizzieren Von Maschinenteilen In Perspektive - Menschenrechte Und Entwicklungszusammenarbeit - Theory And Strategy In Histochemistry - Die Vereinten Nationen Im 21 Jahrhundert - Wissenschaftssoziologie - Lehrbuch Der Mathematik Wirtschaftswissenschaften - Soziologische Aufklrung 6 - Politik Und Regieren In Hessen - Moderner Kaufmnnischer Schriftverkehr - Metropolitan Governance In Deutschland - Durch Die Usa Und Canada Im Jahre 1887 - Invertebrate And Fish Tissue Culture - Aktivposten Wissenskapital - Biological Coherence And Response To External Stimuli - Investment Confidence And Business Cycles - Elektro-fachkunde - Bilanzen - Modellbildung Und Simulation - Neurocritical Care - Der Apotheker Als Subjekt Und Objekt Der Literatur - Kinder- Und Jugendkriminalitt - Die Taxation Maschineller Anlagen - Neoplasms Of The Liver - Automobilelektronik - Das Surebestndige Email Und Seine Industrielle Anwendung Im Apparatebau - Der Urknall - Freie Durchforstung - Einfaches Pharmakologisches Praktikum Mediziner - Handbuch Politische Gewalt - Erinnern Und Vergessen - Die Milz The Spleen - Der Ausbau Der Wirtschaftlichen Einteilung Des Wege- Und Schneisennetzes Im Walde - Nuklearmedizin In Der Orthopdie - Geschichte Der Csu - –konomie Der Medien Und Des Mediensystems - Publizistik Im Vernetzten Zeitalter - Handbuch Der Experimentellen Pharmakologie - Furcht Und Freiheit - Wahrscheinlichkeitsrechnung Und Stochastische Prozesse - Deutsches Kranbuch - Neukundengewinnung Durch Dialogkommunikation - Bankdienstleistungen Kundenorientiert Verkaufen - Giant Intracranial Aneurysms - Kompendium Weiterbildung - Die Praktische Werkstoffabnahme In Der Metallindustrie - Ebene Und Rumliche Rahmentragwerke - Feuerungstechnik Mit Steinkohlen Oberschlesiens - Transputerpraktikum - Progress In Hydrogeochemistry - Erfolgreiches It-management Im Ffentlichen Sektor - Handbuch Sozialraum - Grundriss Soziale Arbeit - Goethes Naturwissenschaftliches Denken Und Wirken - Die Zukunft Der Gemeinwesenarbeit - Transportmanagement - Chancen Das Deutsche Gesundheitssystem - Partnerwahl Und Heiratsmuster - Autochthone Modernitt - Die Enquete-kommissionen Des Deutschen Bundestages - Beitrag Zur Frage Der Zeitermittlung Und Zur Planmyig-wissenschaftlichen Arbeitszuweisung Bzw Gruppenzusammensetzung Bei Reinen Handarbeiten Auf Grund Arbeitswissenschaftlicher Untersuchungen Besonders An Schlosserarbeiten - Allgemeine Wechselstromlehre - A Second Generation Pacs Concept - Werbe- Und Konsumerziehung International - Werkzeugspanner Werkzeughalter - Die Rekonstruktion Ostmitteleuropas - Einhrung In Die Pathologische Physiologie - Muslimische Patienten Pflegen - Static Electrification - Sich Schn Machen - Unvollstndige Akteure - Neonatal Tumours - Automatisierungstechnik Kompakt - Lumbar Spinal Stenosis - Standardisierte Krebsbehandlung - Fruchtwechsel In Der Forstwirtschaft - Organisationsbezogenes Qualittsmanagement - Das Prinzip Mtterlichkeit - Geschlechterbergreifende Soziale Ressource - Computer Animation 90 - Schutz Als Neue Norm In Den Internationalen Beziehungen - Journalismus Und Wandel - Das Phnix-phnomen - Management Der Wertschpfungsketten In Banken - Lsungen Mandantenorientierte Sachbearbeitung - Analyse Der Fette Und Wachsarten - Geschichte Der Politikwissenschaft - Learn Objective-c On The Mac - Pathologie Der Ableitenden Harnwege Und Der Prostata - Sustainability In Tourism - Controlling-management - Mhc + X - Betriebswirtschaftslehre Den Bankkaufmann - Automobillogistik - Datenverarbeitung Bauingenieure - Variational And Finite Element Methods - Technologie Der Textilfasern - Doomed To Internationalization And Modernization Of Corporate Culture - Angewandte Soziologie - Lokale Publizistik - The Sages Manual - Angewandte Phnomenologie - Entomology - 100 Minuten Den Kompetenten Auftritt - Handbuch Politische Partizipation Von Frauen In Europa - Beginning Ios 5 Games Development - Die Technologie Des Maschinentechnikers - Denken Und Erkennen Im Kybernetischen Modell - Kolbendampfmaschinen Und Dampfturbinen - Besondere Osteosynthesetechniken - Fernsehgebrauch Und Geschlecht - Das Deutsche Parteiensystem - Soziologische Aufklrung 1 - Die Trockentechnik - Geldanlage Mit Optionen Und Futures - Identittsfalle Oder Weltbrgertum - Phantasie Und Realitt In Der Sptadoleszenz - Digitale Lernwelten - Psychopharmaka Im Widerstreit - Afrika Jahrbuch 1989 - Metabolic Reactions In The Nervous System - Die Behandlung Und Verhtung Der Rachitis Und Tetanie - Economic Diplomacy - Handbuch Der Thoraxchirurgie Encyclopedia Of Thoracic Surgery - Grundkurs Politikwissenschaft Einhrung Ins Wissenschaftliche Arbeiten - Gottfried Benn - Pathologie Und Bakteriologie Der Endokarditis - Singles - Wrterbuch Der Marxistisch-leninistischen Soziologie - Reibung Und Schmierung Fester Krper - Aktuelle Herausforderung In Der Gefychirurgie - Schwarze Lcher Im All - Multi-media Und Marketing - Entwicklung - Das Kniegelenk - Advancing The Technology Of Bileaflet Mechanical Heart Valves - Erlebnisse Eines Alten Parlamentariers Im Revolutionsjahre 1848 - Handbuch Geschlechterforschung Und Fachdidaktik - Modalitt Im Deutschen - Jugend Und Arbeitswelt - Mg2+ And Excitable Membranes - Learn Electronics With Arduino - Testmanagement Bei Sap-projekten - Der Friedensvertrag Und Deutschlands Stellung In Der Weltwirtschaft - Italien - Wahlkampf In Baden-wrttemberg - Endocytosis - Immigranten Im Wohlfahrtsstaat - Die Entropie-diagramme Der Verbrennungsmotoren Einschlieylich Der Gasturbine - Allgemeine Konstitutionslehre - Englands Zivilprozey - Resourcing - Vertrauen Und Kooperation In Der Arbeitswelt - A History Of Fishing - Politische Teilkulturen Zwischen Integration Und Polarisierung - Technischer Lehrgang Hydraulische Systeme - Die Induktive Wrmebehandlung - Allgemeine Theorie Der Menschlichen Haltung Und Bewegung - Differentialdiagnose Seltener Lungenerkrankungen Im Rntgenbild - Atlas Des Mittel- Und Zwischenhirns Des Kaninches - Programmierte Einhrung In Die Betriebswirtschaftslehre - Illustrirtes Repetitorium Der Pharmaceutisch-medicinischen Botanik Und Pharmacognosie - Hessen Im Wandel - Das Sprengluftverfahren - Ingenieur Und Wirtschaft Der Wirtschafts-ingenieur - Das Wealth-management-team In Der Kundenbetreuung - Ferdinand Graf Von Zeppelin - The House Mouse - Biochemie Und Physiologie Der Sekundren Pflanzenstoffe - Wissen Managen Mit Innovativer Informationstechnologie - A Politics Of Inevitability - Kausalgesetz Und Willensfreiheit - Dft - Diskrete Fourier-transformation - Der Baugrund - Das Kupferschweiyverfahren Insbesondere Bei Lokomotiv-feuerbchsen - Statistical Theory Of Heat - Psychotherapie Als Transformationsprozey - Soziologische Forschung Stand Und Perspektiven - Migration Sprache Und Kulturelles Kapital - Grenzen Und Grenzberschreitungen Der Liebe - Spannbetontrger - Kinderarmut In Der Bundesrepublik Deutschland - Rollenmodelle Der Hrung - Viele Welten - Anatomie Und Physiologie - Unternehmerhandbuch Bau - Was Lsst Ehen Heute Noch Gelingen - Shock Waves @ Marseille Ii - Rahmentragwerke Und Durchlauftrger - Technischer Ausbau Von Gebuden - Die Biologischen Grundlagen Der Sekundren Geschlechtscharaktere - Geschftsmodelle Quadruple Play - Bild Und Gegenbild Die Usa In Der Belletristik Der Sbz Und Der Ddr Bis 1987 - Phnomenologie Und Soziale Wirklichkeit - Cardiology For The Primary Care Physician - Warum Benjamin Franklin Nicht Vom Blitz Erschlagen Wurde - Die Knstlichen Kohlen Elektrische –fen Elektrolyse Und Elektrotechnik - 25 Jahre Kaiser Wilhelm-gesellschaft - Sachsen-anhalt - Rechtsradikale Gewalt Im Vereinigten Deutschland - Mutter Tochter Anne Kiz - „franz Oppenheimer - Computergesttzte Fuychirurgie - Systemtransformation - Grundzge Der Zerspanungslehre Theorie Und Praxis Der Zerspanung Bau Und Betrieb Von Werkzeugmaschinen - Corneal Sensitivity - Stochastic Processes - Griechische Kriegsaltertmer Hhere Lehranstalten Und Den Selbstunterricht - Atlas Of Fine Needle Aspiration Cytology - Sensoren In Wissenschaft Und Technik - Caryophyllales - Der Durchlaufende Bogentrger Auf Elastischen Sttzen Mit Und Ohne Versteifungstrger - Patientenwelten - Principles Of Quantum Mechanics - Advanced Combustion Science - Abtastregelung - Dictionary Of Global Climate Change - Das Recht Zur Qualitt - Wahlsysteme Und Systemwechsel In Osteuropa - Patient Krankenhaus - Anticipative Criminal Investigation - Die Volkskammer Der Ddr - Werte Messen Werte Schaffen - Der Gmbh-geschftshrer - Soziologische Theorie Und Empirie - Sicherheitspolitik In Lateinamerika - Wahlen 2002 In Sachsen-anhalt - Unternehmen Im Wettbewerb - Jugendliche Und Drogen - Die Wirtschaftliche Und Soziale Lage Der Technischen Privatangestellten In Der Deutschen Elektroindustrie - Energierecht - Sexuelle Traumatisierung Und Ihre Folgen - Expert Systems In Environmental Planning - Erfolgreich Verkaufen Im Handel - Konfigurationen Lebensweltlicher Strukturphnomene - Sehnenverletzungen Und Sehnen-muskeltransplantationen - Kommunikationswissenschaft Als Integrationsdisziplin - Die Gedanken Werden Handgreiflich - Der Sozialrumliche Blick Der Jugendarbeit - Statistik Leicht Gemacht - Gynkologie Und Geburtshilfe 1994 - Die Insulinshockbehandlung Der Schizophrenie - Medienrezeption Als Aneignung - Frankreich Jahrbuch 2003 - Die „vergessenen Frauen Aus Der Zuwanderergeneration - Prognoserechnung - Heidelberg Im Schnittpunkt Intellektueller Kreise - Algebra Und Zahlentheorie - Anwendung Geophysikalischer Methoden In Der Hydrogeologie - Gleichgewicht Und Reibungslose Bewegung - Technische Mechanik Festigkeitslehre - Lebensthemen Junger Frauen Die Andere Vielfalt Weiblicher Lebensentwrfe - Scientific Computing In Chemical Engineering - Sende- Und Empfangsdioden Die Optische Nachrichtentechnik - Feuerungsuntersuchungen Des Vereins Feuerungsbetrieb Und Rauchbekmpfung In Hamburg - Histologischer Atlas Von Zupfprparaten Unfixierter Menschlicher Organe Und Gewebe - Die Zukunft Der Werbeagenturen - Operative Gynkologie - Morphometry Of The Human Lung - Epidemiology Of Prostate Disease - Zwischen Wettbewerbs- Und Verhandlungsdemokratie - Mathematik Im Abendland - Lebensqualitt-atlas - Verkehrsmedizin - Computergraphik Und Bildverarbeitung - Stadtmarketing - Nierentransplantation - Klinik Der Darmkrankheiten - Entwerfen Und Herstellen - Habsburg Und Hohenzollern - Einhrung In Die Empirische Sozialforschung - 50 Jahre Kongress Innere Medizin 18821932 - Grungschemisches Praktikum - Handbook Of Pediatric Cardiovascular Drugs - Single-photon-emissions-computertomographie Spect Des Gehirns - Benign Prostatic Hyperplasia - Von Der Fachschule In Die Hochschule - Customer Banking - Bosch Grundlagen Fahrzeug- Und Motorentechnik - Synthetic Aspects Of Aminodeoxy Sugars Of Antibiotics - Sql Server 2012 Integration Services Design Patterns - Rollenspiele In Kommunikations- Und Verhaltenstrainings - Die Zerspanbarkeit Der Metallischen Und Nichtmetallischen Werkstoffe - Chirurgische Gastroenterologie - Technology Acceptance In Education - Innovatorenorientierte Akzeptanzforschung Bei Innovativen Medientechnologien - Der Euro-kapitalmarkt - Kinderarmut Und Generationengerechtigkeit - Grundlagen Des Maschinellen Beweisens - Unixâ„¢ Das Betriebssystem Und Die Shells - Projektierung Von Automatisierungsanlagen - Institutionelle Erneuerungsfhigkeit Der Forschung - Notflle In Gynkologie Und Geburtshilfe - Mensch-computer-kommunikation - Elektrische Energieerzeugung - E-learning In Der Beruflichen Bildung - Das Dilemma Des Modernen Mannes - Analysis - Current Practice Of Fracture Treatment - Parteien Und Fraktionen - Protest-inszenierungen - Fachkunde Elektroberufe - Kinderlosigkeit In Deutschland - Aspects Of Central Bank Policy Making - Periphere Osteosynthesen - Vom Nil Zum Neckar - Jakob Michael Reinhold Lenz - Quantitative Marketing And Marketing Management - Das Prfungsbuch - Leitfaden Zum Berechnen Und Entwerfen Von Lftungs- Und Heizungs-anlagen - Das Subdurale Hmatom - A Short Textbook Of Clinical Imaging - Wege Zu Effektiven Psychotherapien - Derivate Im Risikomanagement Von Fuyballunternehmen - Apothekengesetze - Die Soziologie Theodor Geigers - Regulierung Und Unternehmenspolitik - Assistenzinteraktionen - Von Der Deutschlandpolitik Zur Ddr-politik - Praxis Der Brustoperationen - Bacillus Thuringiensis Biotechnology - Qualifizierte Facharbeit Im Spannungsfeld Von Flexibilitt Und Stabilitt - Moral Und Recht Im Diskurs Der Moderne - Symptomorientierte Diagnostik Bei Aphasien - Alle Macht Den Banken - Bauphysikalische Aufgabensammlung Mit Lsungen - Geld- Und Bankwesen - Leitfaden Gerbereichemische Untersuchungen - Betriebsverrechnung In Der Chemischen Groyindustrie - Kommunalpolitik In Den Deutschen Lndern - œber Norbert Elias - Bildungsdienstleistung Elearning - Grundzge Des Eisenhttenwesens - Gewerkschaftliche Jugendpolitik Zwischen Hbv Und Verdi - Frequency Standards And Metrology - Demokratie Und Auyenpolitik In Lateinamerika - Opus Dei Und Scientology - Imaging And Technology In Urology - Grundlagen Der Konstruktion - Wirkung Nach Plan - Querdenken Im Marketing - Wortgefecht Und Sprachverwirrung - Pathologische Physiologie - Radiobiology In Radiotherapy - The Making Of Regions In Post-socialist Europe The Impact Of Culture Economic Structure And Institutions - Unix Software-entwickler - Fehler Und Fehlerschutz In Elektrischen Drehstromanlagen - Bibliographie Der Luftfahrtmedizin - Rntgendiagnostik Im Kindesalter - Illokutionre Krfte - Beitrge Zur Photographie Der Blutspektra Unter Bercksichtigung Der Toxikologie Der Ameisensure - Rituale Der Transformation - Grundlagen Der Errichtung Elektrischer Anlagen In Explosionsgefhrdeten Betrieben - Theoretische Grundlegung Ethischer Bankbetriebslehre - Stochastik Einmal Anders - Peter Weiss Jahrbuch 3 - Die Entstehung Der Internationalen Maye Der Elektrotechnik - Die Cerebrospinalflssigkeit - Elektrische Industriefen Weiterverarbeitung - Fehlerwelten - Tuberculosis Of The Skeleton - Innovative Logistik - Der Einsatz Der Bundeswehr In Afghanistan - Lehrbuch Der Bauphysik - Schler Und Politik - Lehrbuch Der Kinderkrankheiten - Contributions To Functional Analysis - 100 Minuten Konfigurationsmanagement - Die Pflegeversicherung - Knig Brgermeister Bundeskanzler - Eskalation Durch Berichterstattung - Leitfaden Der Gynkologie - Machtkonzentration In Der Multimediagesellschaft - Betriebswirtschaftliche Hrungslehre Grundlagen Strategien Modelle - Technische Mechanik 2 - Die Technik Des Orthopdischen Eingriffs - Sonographische Diagnostik In Der Unfallchirurgie - Journalismus Als Kultur - Stereotactic Techniques In Clinical Neurosurgery - Higher Education And Human Capital Rethinking The Doctorate In America - Gesundheit Und Soziale Lage Von Jungen Menschen In Europa - Ultraschalldiagnostik 88 - Lineare Algebra Und Lineare Programmierung - Allgemeine Energiewirtschaftslehre - Einfuhrung In Die Wellenmechanik - Wahlen Und Europische Einigung - Afrika Jahrbuch 1990 - Miteinander Von Kindern Und Alten Menschen - Mnemotechnik Der Receptologie - Six Sigma+lean Toolset - Runder Tisch Und Direkte Demokratie - Das Politische System Belgiens - Atomic And Nuclear Clusters - Tiefbohrgerte - Kolonisierung Oder Integration - Sicherheit Und Integration In Europa - Formeln Und Tabellen Elektrotechnik - Arbeitsrecht 2 - E-learning - Atm Networks - Disorder Effects On Relaxational Processes - Organisation Des Rundfunks - Antidiskriminierungspdagogik - Das Licht Im Grundsystem Des Kohlenhydratstoffwechsels - Gerechtigkeit In Der Schule - Die Pathologisch-histologischen Untersuchungsmethoden - Einhrung In Die Feinstruktur Von Zellen Und Geweben - Die Bodenaziditt - Das Energiewirtschaftsproblem In Bayern - Pathology Of The Pancreas - Die Politik In Der Kunst Und Die Kunst In Der Politik - 15 Darstellungstheorie Der Endlichen Gruppen - Die Neuzeitliche Seidenfrberei - Stochastische Automaten - Koordination Von Supply Chains Durch Mengenbindungsvereinbarungen - Investitionstheorie Und Investitionspolitik Privater Und Ffentlicher Unternehmen - Cognitive Psychotherapy - Gewsser Als –kosysteme - Gewerbepolizeiliche Vorschriften Die Errichtung Und Den Betrieb Gewerblicher Anlagen - Lokale Politik Und Verwaltung Im Zeichen Der Krise - The Sages Manual On The Fundamental Use Of Surgical Energy Fuse - Personale Gesundheitliche Und Umweltressourcen Im Alter - Unternehmen Berlebensfhig Machen - Genetic Approaches To Coronary Heart Disease And Hypertension - Informelles Regieren - Die Auflsung Von Aktienfonds - Sozialstaat Und Demographischer Wandel - Wissenstransfer Deutscher Universitten - Konfliktmanagement Und Gewaltprvention - Neurogenetik - Data Compression - Starthilfe Bwl - Hauptfragen Der Reichsbahnpolitik - Diagnostik Und Therapie Der Lungen- Und Kehlkopftuberkulose - Die Physikalischen Grundlagen Der Anwendung Radioaktiver Oder Stabiler Isotope Als Indikatoren - Die Rztliche Visite - Macromolecules · 1 - Parlamente Und Ihre Funktionen - Soziologische Beratungsforschung - Opportunities And Constraints Of Parallel Computing - Handbook Of Children With Special Health Care Needs - Das Heartbeat-modell - Pornografie An Kindern - Pdagogik Die Kinder Stark Macht - Dynamik Der Kraftfahrzeuge - Materialwirtschaft Und Einkauf - Moral Kommunikation Organisation - Pacific Cooperation From The Japanese And The German Viewpoint - Grassroots-campaigning - Der Heutige Stand Der Chemotherapeutischen Carcinomforschung - Personalauswahl Ii - Kunstseide Und Zellwolle Nach Dem Viskose-verfahren - Rationalitten Des Kinderschutzes - Alltag Im Kz - Der Verband Der Hochschullehrer Betriebswirtschaft - Kunden Auf Dauer Binden - Temperatur Und Leben - Automation Of Cytogenetics - Demografischer Wandel In Der Unternehmerischen Praxis - Grundlagen Von Informationssystemen - Neue Werkstoffe - Die Stadt Des Neuen Bauens - Tatort Biographie - Klinische Anatomie Des Ohres - Psychiatrie In Der Literatur - Die Ordnung Der Freiheit - Progressive Multiple Sclerosis - Adhesives Technology Compendium 2009 - Managementvergtung Anreize Und Kapitalmarkterwartungen - Methoden Und Architekturen Der Softwaretechnik - The Interferon System - Symbol Und Soziologische Symboltheorie - New Horizons In Media Psychology - Georg Luk¡cs - Umweltbelastungen Und „ngste - Die Verwaltung Der –ffentlichen Arbeiten In Preussen 1890 Bis 1900 - Europische Integration - Handwrterbuch Des Postwesens - Verwaltungscontrolling - Metaphern Und Gesellschaft - Stereoselective Synthesis - Coronary Artery Graft Disease - Benzodiazepines Ii - Pseudocholinesterasen - Meaning And The Growth Of Understanding - Online-journalismus - Der Hirnstamm Der Maus - Die Gegenwrtigen Strmungen In Der Psychiatrie - Medizinische Mykologie In Praxis Und Klinik - Deutsche Direktinvestitionen In Der Volksrepublik China - Klinische Vektor-elektrokardiographie - Dynamik Von Schadstoffen Umweltmodellierung Mit Cemos - Day Treatment For Children With Emotional Disorders - Adp-ribose Transfer Reactions - Konsumentenpsychologie Und Markenartikel - Hartmetalle - 5 Kongrey Der Deutschsprachigen Gesellschaft Intraokularlinsen Implantation - Augenpraxis Nichtspezialisten - Proceedings Of The First Lunar International Laboratory Lil Symposium Research In Geosciences And Astronomy - Arbeitslosengeld-ii-bezug Im œbergang In Das Erwerbsleben - Alternative Investments Verstndlich Verkaufen - Degradation Phenomena On Polymeric Biomaterials - Kompaktkurs Physik - Meningitis Im Kindesalter Und Neugeborenensepsis - The Mathematics Of Computerized Tomography - Journalisten Zwischen Den Fronten - –kologische Gebudetechnik - Dauermagnete - Lehrbuch Der Speziellen Pathologie Und Therapie Der Inneren Krankheiten Studierende Und „rzte - Operatorenrechnung - Differential- Und Integralrechnung - Audiovisuelle Fernkommunikation - Bau Und Eigenschaften Der Organischen Naturstoffe - Optimum And Equilibrium For Regional Economies - Surgery Of Basal Cell Carcinoma Of The Face - Praktische Informatik - Eine Einhrung - Interkulturelle Pdagogik Und Sprachliche Bildung - Bevlkerungssoziologie - The Biology Of Subcellular Nitric Oxide - Gottfried Benn Rainald Goetz - Corrosion Of High-performance Ceramics - Tatort Sozialstaat - Elementary Particle Physics - Die Garnverarbeitung - Kritische Empirie - Atlas Of Mammography - Environmental Hygiene - Intracranial Pressure Viii - Wave Propagation In Dissipative Materials - Contested Public Spheres - An Introduction To Theoretical Geomorphology - Change Power - Recent Developments In Unmanned Aircraft Systems - Der Kationen- Und Wasserhaushalt Des Mineralbodens - Berlin Von Der Geteilten Zur Gespaltenen Stadt - Hrtbarkeit Und Auswahl Von Sthlen - Bioanalytik - Neueste Ergebnisse Ber Betamimetika - Trkische Unternehmensgrndungen Von Der Nische Zum Markt - Timingstrategien In Innovationspartnerschaften Der Deutschen Ernhrungsindustrie - Die Neuropathologischen Syndrome - Die Frderung Von Massengtern - Treatment With Gallopamil - Ermittlung Der Billigsten Betriebskraft Fabriken - Prototyping Komplexer Softwaresysteme - Betriebswirtschaftliche Steuerlehre - Die Raumbeziehungen Im Wirtschaften Der Welt - Event-based Programming - Vernetzte Wirtschaft Und Konomische Entwicklung - Hochfrequenz- Und Lasertechnik In Der Medizin - Geoelektronik - Funktionalisierung Von Duroplastischen Faserverbundwerkstoffen Durch Hybridgarne - Was Heiyt Individualisierung - Die Gesellschaftlichen Folgen Der Medienkonzentration - Vorkurs Informatik - Umwelt Beschftigung Und Zukunft Der Wachstumsgesellschaften - Soziologische Aufklrung 5 - Das Abc Des Verkaufserfolgs - Power Transducers For Sonics And Ultrasonics - Pdagogen In Studium Und Beruf - Die Groyen Revolutionen Und Die Kulturen Der Moderne - Konfliktmanagement Bei Groupware - Einhrung In Die Halbleitertechnologie - Anlagechancen 2008 - Gammopathy - Fortschrittliche Lagerung Und Behandlung Schwerverwundeter - Tidal Deposits - Clusters In Automotive And Information And Communication Technology - European Monetary Integration - Phytopharmaka In Forschung Und Klinischer Anwendung - Biokatalyse - Der Erdwachsbergbau In BorysÅ‚aw - Interregional Migration - Biotransformation Der Arzneimittel - –ffentliche Sozialforschung Und Verantwortung Die Praxis - Contemporary Research On Renal Cell Carcinoma - Formen Der Eigenarbeit - Mixed Methods - Sozialisation In Kologischer Perspektive - Die Bundestagswahlkmpfe Der Fdp 1949 2002 - Applied Ontology Engineering In Cloud Services Networks And Management Systems - Nahost Jahrbuch 2004 - Intraoperative Neurophysiologic Monitoring In Neurosurgery - Anlage Ausbau Und Einrichtungen Von Frberei- Bleicherei- Und Appretur-betrieben - œberflle Und Wehre - Kugelpackungen Von Kepler Bis Heute - Soziales Handeln Und Strukturelle Selektion - Die Europische Union - Experimental Analysis Of Insect Behaviour - Wahrnehmung Und Herstellung Von Geschlecht - Schwingungen In Natur Und Technik - Ultraschalldiagnostik 86 - Stochastic Optimal Control And The Us Financial Debt Crisis - Der Alltgliche Kampf In Organisationen - Atlas Of Peripheral Nerve Ultrasound - Der Modellbau Die Modell- Und Schablonenformerei - Marine Geochemistry - Myelin - Naturwissenschaftliche Bildung In Deutschland - Riemanns Geometrische Ideen Ihre Auswirkung Und Ihre Verknpfung Mit Der Gruppentheorie - Selbstwertmanagement - Wutz Handbuch Vakuumtechnik - Lebenslagen Soziale Ressourcen Und Gesellschaftliche Integration Im Alter - Soziale Konstruktion Von Geschlecht Im Sport - Kompakt-lexikon Umwelt- Und Wirtschaftspolitik - Sicherheit In Netzgesttzten Informationssystemen - Echokardiographische Diagnostik Bei Koronarer Herzkrankheit - Wissenschaftliche Weiterbildung Als Transformationsprozey - Messen Im Wandel - Betrachtungen Eines In Deutschland Reisenden Deutschen - Zwischen Resignation Und Gewalt - Familienunternehmen Auslaufmodell Oder Erfolgstyp - Mathematik Informatiker - Advances In Flow Research - Lean Management In Krankenhusern - Plurale Sozialstrukturanalyse - Politikwissenschaft Als Kulturwissenschaft - Aerodynamik Der Stumpfen Krper - Essential Hypertension - Basiswissen Investition Und Finanzierung - Verbundtrger - Die Aktiengesellschaft Nach Den Vorschriften Des Handelsgesetzbuchs Vom 10 Mai 1897 Dargestellt Und Erlutert Unter Angung Eines Normalstatuts - Applied Mathematics For Database Professionals - Drogisten-lexikon Ein Lehr- Und Nachschlagebuch Drogisten Und Verwandte Berufe Chemotechniker Laboranten Groyhandel Und Industrie - Proceedings Of The Twelfth International Conference On The Physics Of Semiconductors - Tropische Hochgebirgspflanzen - Berufsbiographien - Anleitung Zur Bearbeitung Meteorologischer Beobachtungen Die Klimatologie - Systemwechsel 3 - Aktiengesellschaft Und Holdinggesellschaft In Der Schweiz Geltendes Recht Und Revision - Erschpfte Familien - Steinkohlenteer - Concise Cardiology - Autocad-aufbaukurs - Die Entgrenzung Der Mnnlichkeit - Peter Weiss - Kapital Und Kompetenz - Handbuch Der Chemischen Untersuchung Der Textilfaserstoffe - Aids Leitlinien Die Praxis - Rendite Mit Gutem Gewissen - X-ray Microscopy - Applied Control Of Manipulation Robots - Die Westeuropischen Gesellschaften Im Vergleich - Diamantbohrungen Schrf- Und Aufschluyarbeiten Ber Und Unter Tage - Immunoassays In Coagulation Testing - Atmung Aufnahme Und Abgabe Gasfrmiger Stoffe - Die Charta Der Grundrechte Der Europischen Union - Die Funktionsprfung Des Akustischen Und Statischen Labyrinths - Regulation Of Coronary Blood Flow - Einstieg In Die Wirtschaftsmathematik - Peripheral Blood Stem Cell Autografts - Ada - Pps-systeme Und Organisatorische Vernderungen - Towards An Ecologically Sustainable Growth Society - Impulsschaltungen - Surgical Oncology - Grundkurs Mathematik Ingenieure - Quantenmechanik Und Weimarer Republik - Gewerkschaften In Der Japanischen Politik Von 1970 Bis 1990 - Stahlrohrkonstruktionen - Die Permeabilittspathologie - Psychologie Als Gesellschaftswissenschaft - Klausurtraining Hydrochemische Berechnungen - Wissensmanagement Marketing Und Vertrieb - Social Media Balanced Scorecard - Immune Consequences Of Trauma Shock And Sepsis - Cellular And Molecular Alterations In The Failing Human Heart - Die Bankgehilfenprfung In Programmierter Form - Paris Die Kulturelle Konstruktion Der Franzsischen Metropole - Lautlos Hren - Technikfolgenabschtzung - Grundlagen Der Gestaltung - Demokratie Und Politik In Der Bundesrepublik 19491999 - Elektrische Maschinenverstrker - Soziale Determinanten Des Drogengebrauchs - Einhrung In Die Methoden Der Sozialwissenschaftlichen Religionsforschung - Die Ironie Gottes - Adaption Und Lernen Von Und In Organisationen - Die Weltausstellung In Philadelphia Und Die Deutsche Industrie - Kostenberechnung Im Ingenieurbau - Nichtlineare Mechanik - Die Theorie Sozialer Schlieyung - Die Hrungsaufgabe - Handbuch Elektrotechnik - Erlebte Kinderheilkunde - Nordrhein-westfalen Und Die Europische Gemeinschaft - Psycho-logic - Progress In Immunology - Innen Beginnen - Rhizodeposition Und Stoffverwertung - Handbuch Laser-strahlenschutz - Infektise Endokarditis - Ehre Oder Amt - Sozialpsychologische Entwicklungstheorien - Regionalisierung Sozialwissenschaftlicher Umfragedaten - Die Massenmedien Im Wahlkampf - Interaktionale Rezeptionsforschung - Herzerkrankungen - Schulqualifikation Und Berufsfindung - Die Konstruktiven Grundlagen Des Wrme- Und Klteschutzes Im Wohn- Und Industriebau - Planung In Der Krise - Geschichte Der Bergbau- Und Httentechnik - Branded Component Strategies - Bericht œber Den Leobener Bergmannstag - Frauen Im Militr - The Climate Of China - Analysis Of Solids In Natural Waters - Regieren Im 21 Jahrhundert Zwischen Globalisierung Und Regionalisierung - Erfolgsmodell Mittelstand - Introduction To Polymer Physics - Robotics And Factories Of The Future 87 - Brger Oder Bettler - Literaturtheorie Und Geschichte - Computergrafik Und Bildverarbeitung - Subverting Borders - Vita-massenez Chemische Untersuchungsmethoden Eisenhtten Und Nebenbetriebe - Source Book Of Flavors - Gewalt Und Fremdenfeindlichkeit Jugendpdagogische Auswege - Knigin Luise - Coole Hauer Und Brave Engelein - Biological Rhythms - Das Framing Von Issues In Medien Und Politik - Perspektiven Auf Kindheit Und Kinder - Vieweg Handbuch Kraftfahrzeugtechnik - Postmoderne Kultur - Rentabel Durch Total Quality Management - Mechanisms And Phylogeny Of Mineralization In Biological Systems - Gasturbinen Und Gasturbinenanlagen - Technische Messungen Bei Maschinenuntersuchungen Und Zur Betriebskontrolle - Die Anfertigung Forstlicher Terrainkarten Auf Grund Barometrischer Hhenmessungen Und Die Wegnetzprojectirung - Immobilien-management - Kommentar Zum Deutschen Arzneibuch 6 Ausgabe 1926 - Handbuch Technische Oberflchen - Zeichenlehre - Clinical Applications Of Cardiac Ct - Datenreisende - Dienstleistungsqualitt - Die Einphasenasynchronmotoren - Grundprinzipien Der Mechatronik - Handbuch Medienarbeit - Methoden In Der Medizinischen Cytogenetik - Berechnung Von Behltern Nach Neueren Analytischen Und Graphischen Methoden - Ausbildungskompass Steuerfachangestellte - Alter Und Methode - Medicinisch-klinische Diagnostik - Atlas Of Color-coded Doppler Sonography - Reform Of Higher Education In Europe - Der Rationelle Getreidebau - Molecular Theory Of The Living Cell - Arzneipflanzenkultur Und Kruterhandel - Kompendium Systembiologie - Die Strukturierung Konomischer Entscheidungsmodelle - Umwelt Global - Jugendarbeitslosigkeit - Cardiac Pathology - Handbuch Soziale Arbeit Und Alter - Wege Erwachsener In Die Welt Der Schrift - Theory Of Mind - Mathe-manga Analysis - Im Schatten Demokratischer Legitimitt - Visual Basic Technische Anwendungen - Handbuch Direct Marketing - Grundkurs Buchhrung - Deutschland Nach Hitler - Die Gleichstrommaschine Ihre Theorie Untersuchung Konstruktion Berechnung Und Arbeitsweise - Kinderpflege - Mathematical Modeling For Complex Fluids And Flows - –ffentlichkeit Als Prozey - Inszenierungen Von Weiblichkeit - Bilanzlehre - Ion Tracks And Microtechnology - Human Melanoma - Abwanderung Und Migration In Mecklenburg Und Vorpommern - Gelegenheit Und Entscheidung - Anatomie Des Menschen Ein Lehrbuch Studierende Und „rƶte - Bilanzierung Nach Hgb Us-gaap Und Ias Im Vergleich - Gustav Adolf Hirn Sein Leben Und Seine Werke - Die Zukunft Kommunaler Betriebe - Eisenbahnausrstung Der Hfen - Journalismus Medien –ffentlichkeit - 100 Rezepte Turbo Pascal - Chemische Sensoren - Kooperation Und Schulentwicklung - Die Chemie Der Pflanzenzellwand - Rntgenphysik - Logistiknetzwerke - Regieren In Der Bundesrepublik Ii - Die Deutschen Lnder - Militr Als Lebenswelt - Innovationen In Einrichtungen Der Familienbildung - Grundlagen Elektrischer Maschinen Und Antriebe - Geometrie Und Algebra Im Wechselspiel - European Populations - Die Gegenwrtigen Behandlungswege Der Kieferschussverletzungen - Flexible Plankostenrechnung Und Deckungsbeitragsrechnung - Grundlagen Der Psychologischen Diagnostik - Der Neue Sozialstaat - Aufgaben Aus Dem Wasserbau - Grundzge Der Praktischen Pharmazie - Regionale Wirtschaftspolitik Im Kooperativen Bundesstaat - Computer Graphics 1987 - Die Nierenfunktionsprfungen Im Dienst Der Chirurgie - Ausgewhlte Kapitel Aus Der Funktionenlehre - Die Art Der Abfindung Bei Der Ablsung Von Forstservituten - Praktischer œbersetzerbau - Glass Chemistry - Der Werdende Mensch - The Economics Of Transformation - E-engineering - Stochastic Structural Dynamics 1 - Wem Gehrt Der Ffentliche Raum - Soziologie Der Ernhrung - Freytags Hilfsbuch Den Maschinenbau Maschineningenieure Sowie Den Unterricht An Technischen Lehranstalten - Soziologische Aufklrung 3 - Specimen Banking - Demokratie In Der Kleinstadt - Acid Rain - Change Management In Der Sozialwirtschaft - Komatse Zustnde - Die Kologische Benachteiligung Der Tropen - Elektro-fachzeichnen 1 - Der Lndliche Raum - The Mediastinum - Raumbildung Bildungsrume - Clay Sedimentology - Produktentwicklung In Der Automobilindustrie - Arzneimittel-atlas 2011 - Endoprosthetics - Die Praxis Der Zahnextraktion Einfchlieylich Der Rtlichen Schmerzbetubung - Architektur Des Mittelalters - Technology Cad Systems - Politisches Wissen Ber Die Europische Union - Der Effekt Der Systemuntersttzung Auf Die Politische Partizipation - Bahnhofsverzeichnis Zum Achsdruckverzeichnis - Die Betriebswirtschaftliche Organisation In Speditionsgroybetrieben - Fluglehre - Bandstrayen Im Baubetrieb - Die Gasbehandlung Bsartiger Geschwlste - Einhrung In Die Experimentalzoologie - Die Strafe Ii - Internationale Unternehmen Gesellschaft Und Verantwortung - Rekonstruktiv-responsive Evaluation In Der Praxis - Die Herstellung Der Feuerfesten Baustoffe - Stiftungsvermgen 2010 - Chefinnen - Fachbegriffe Internationale Rechnungslegungglossary Of International Accounting Terms - Einhrung In Die Maschinenelemente - Bau Einrichtung Und Betrieb Ffentlicher Schlacht- Und Viehhfe - Extrarenale Membranvermittelte Akutwirkungen Von Mineralokortikoiden - Der Absatz In Der Chemischen Industrie - E-government Und Virtuelle Organisation - Renal Transport And Diuretics Renaler Transport Und Diuretica - Information Management For Business And Competitive Intelligence And Excellence - Prozeymanagement Mit System - Nicolaus Steno - China Champions - Medienwirkungen Kompakt - Kinder Zwischen Selbstsozialisation Und Pdagogik - Kundenforum - Konfrontative Pdagogik - Computational Nuclear Physics 1 - Bolivien Politisches System Und Reformprozess 19931997 - 25 Jahre Kaiser Wilhelm = Gesellschaft Zur Frderung Der Wissenschaften - Die Parteien Nach Der Bundestagswahl 1998 - Primary Liver Cancer In Japan - Handbook Of Asian American Health - Pathologie Des Trauma - Der Kontaktumformer - Kritische Kriminologie In Der Diskussion - Markenmanagement - Lohmeyer Baustatik 1 - Unbewuyte Selbstbilder - Die Brgerbewegungen In Der Ddr Und In Den Ostdeutschen Bundeslndern - Zirkulre Positionen 2 - Die Wurzeln Der Westdeutschen Nachkriegsdemokratie - Die Politischen Systeme Sdostasiens - Einhrung In Die Programmiersprache Fortran 77 - Modell „bad Bank Hintergrund - Konzept - Erfahrungen - Managerherrschaft In Deutschland - Adhesion 13 - Struktur Und Ereignis In Theorievergleichender Perspektive - Haut- Und Lederfehler - Soziologische Aufklrung 4 - Die Architekturen Der Menschlichen Knochenspongiosa - Die Cdu Auf Landesebene - Strmungslehre In Fragen Und Aufgaben - Die Performer-methode - Einhrung In Die Markscheidekunde Mit Besonderer Bercksichtigung Des Steinkohlenbergbaues - Die Auyenpolitik Der Baltischen Staaten - Neue Impulse In Der Hochschuldidaktik - Ultrasonography Of The Spleen - Berufswahl Und Bewhrung - Schreiben Ohne Text - Jahrbuch Psychodrama Psychosoziale Praxis And Gesellschaftspolitik 1991 - Theories Of Neurosis - Burn Care And Treatment - Microdosimetry And Its Applications - Numerische Methoden In Der Technik - Die Bndel-nagelung Experimentelle Und Klinische Studie Ber Eine Neuartige Methode Der Markraum-schienung Langer Rhrenknochen - Handbuch Kriegstheorien - Total Knee Replacement - Rechnen In Der Verfahrenstechnik Und Chemischen Reaktionstechnik - Tensor Analysis And Continuum Mechanics - Derivate Arbitrage Und Portfolio-selection - Chemical Structures - Psychiatriereformen Zwischen Medikalisierung Und Gemeindeorientierung - Terminalserver Mit Citrix Metaframe Xp - Effektive Sicherheit - Schlsselwerke Der Postcolonial Studies - Das Politische System Der Niederlande - Employer Branding - Schlackenkunde - Jugend Und Jugendpolitik In Benachteiligten Stadtteilen In Europa - Beginning Ios 5 Development - Introduction To The Theory Of Benzenoid Hydrocarbons - Die Gewerkschaften In Politik Und Gesellschaft Der Bundesrepublik Deutschland - Atlas Der Hmatologischen Zytologie - Das Herz Und Die Blutgefye - Bibliographie Der Verffentlichungen Ber Den Leichtbau Und Seine Randgebiete Im Deutschen Und Auslndischen Schrifttum Aus Den Jahren 1955 Bis 1959 Bibliography Of Publications On Light Weight Constructions And Related Fields In German And Foreign Literature From 1955 To 1959 - Ion Channels - Lobbyismus Im Klimaschutz - Ohne Panik Strmungsmechanik! - Aufbau Betrieblicher Informationssysteme - Computer-generated Images - Kulturmanagement Ii - Altern Ein Lebenslanger Prozey Der Sozialen Interaktion - Pressefreiheit Unter Druck - Acta Historiae Neerlandicae Ix - Postscript Level 2 Griffbereit - Proceedings Of A Conference On Local Fields - Acute Pancreatitis - Bildungsgangdidaktik - Rezepttaschenbuch Nebst Anhang - Hren Im Ffentlichen Bereich Und In Non-profit-organisationen - O Tempora O Mores - Marine Geology And Oceanography Of The Arctic Seas - Wirtschaftsmathematik Leicht Gemacht - Das Wachstum Von Verwaltungsorganisationen - Host Defense Dysfunction In Trauma Shock And Sepsis - Applied Dynamics Of Manipulation Robots - Kulturwissenschaftliche Hermeneutik - Atlas Der Normalen Und Pathologischen Handskeletentwicklung - 9 Kongrey Der Deutschsprachigen Gesellschaft Intraokularlinsen Implantation - Die Diagnose Des Kleinen Magenkrebses - Der Innovative Staat - Kampf Um Zugehrigkeit - Islamophober Populismus - Analysis Mit Maple - Benchmarking - Science Education In International Contexts - Gebrochene Identitten - Grundzge Der Physik - Proceedings Of The Fourth Conference On Origins Of Life - Qualittssicherung Durch Softwaretests - Politikwissenschaft In Der Bundesrepublik Deutschland - Die Geburt Der Schnen Bilder - Recent Developments In Alcoholism - Radiologische Funktionsdiagnostik Des Pharynx Und Des –sophagus - Elektrotechnik Auf Handelsschiffen - Grundriy Der Physik Naturwissenschaftler Mediziner Und Pharmazeuten - Groyeltern In Europa - Facets Of Vision - The Statistical Analysis Of Categorical Data - Sonographische Diagnostik Des Skrotalinhalts - Unfall- Und Wiederherstellungschirurgie Des Schultergrtels - Curriculum »politik« - Cochlea-implantat - Der Waldwegbau Und Seine Vorarbeiten - Physical Property Prediction In Organic Chemistry - Schweiytechnisches Konstruieren Und Fertigen - Nonconventional Yeasts In Biotechnology - Mr Imaging Of The Skull And Brain - Konstruktive Geometrie In Der Technik - Kohlberg Und Seine Kritiker - Nichttraumatische Querschnittlhmungen - Theorie Und Technik Der Pulsmodulation - Geboren 1964 Und 1971 - Die Grundlagen Zur Besserung Der Stdtischen Wohnverhltnisse - Gesellschaft Mit Beschrnkter Hoffnung - Dielektrisches Material - Hepatocellular Carcinoma - Integration Of Preference Analysis Methods Into Qfd For Elderly People - Chemistry And Biology Of Solid Waste - Wagnisse Der Anpassung Im Arbeitsalltag - Umwandlungssteuer - Politische Kommunikation Im Internationalen Vergleich - Mathematik Wirtschaftswissenschaftler - Formeln Und Tabellen Stahlbau - Schweigen Und Verschweigen - Scham Ein Menschliches Gehl - E-bilanz - Buchhrung Speditionskaufleute - Talentmanagement Mit System - Programmierung Mit Fortran 77 - Models And Measurement Of Welfare And Inequality - Chemical Water And Wastewater Treatment Ii - Workflow-management In Verteilten Systemen - Graphenalgorithmenprogramme - Selektivschutz - Regional Science - Terminhandel - Integriertes Content Management In Fernsehunternehmen - Handbuch Kindheits- Und Jugendforschung - Erziehungs- Und Bildungspartnerschaften - Interaktionsordnungen - Gegenbilder - Die Urteilsbildung In Der Psychodiagnostik - Schreiben In Werbung Pr Und Journalismus - Density Functional Theory - Hereditary Colorectal Cancer - City-management - Qualitative Psychologie - Wert- Und Bedrfnisorientierte Segmentierung Von Konsumgtermrkten - Sterben Und Tod - The Physiology Of The Compound Eyes Of Insects And Crustaceans - Gouvernementalitt Und Biopolitik - Craniofacial Surgery - Vieweg C++ Toolbox - Macht Und Herrschaft - Ultraschalldiagnostik 90 - Grundzge Der Pflanzenanatomie - Die Stereoskopie - Functional Instability Or Paradigm Shift - The Chemical Physics Of Surfaces - Content Management Integrierter Medienprodukte - Infinitesimalrechnung - Advanced Technology In Neurosurgery - Ngos Als Legitimationsressource - Lehrbuch Der Herzkrankheiten - Die R- Evolution Im Informationsmanagement - Caspar Neher Der Gryte Bhnenbauer Unserer Zeit - Optimierung - Religious Tolerance Education And The Curriculum - Coronary Circulation In Physiological And Pathophysiological States - Managementmaynahmen Gegen Produktpiraterie Und Industriespionage - 1632 Bit-mikroprozessorsysteme - Gerichtsrztliche Untersuchungen - Organtransplantation In Rats And Mice - An Outline Of Neurosurgery - Amerikanische Wirtschaftspolitik - The Embryology Of The Human Locomotor System - Die Reichsdienststrafordnung Rdsto - Jugend Und Differenz - Benjamin Constant Und Der Liberale Verfassungsstaat - Symmetrische Verschlsselungsverfahren - Service-exzellenz - Grundlagen Der Materialwirtschaft - High Energy Astrophysics - Politische Parteien Im Demokratisierungsprozess - Ellbogenchirurgie In Der Praxis - Ergebnisse Der Hygiene Bakteriologie Immunittsforschung Und Experimentellen Therapie - Regieren Und Intergouvernementale Beziehungen - Steuerung Versus Emergenz Entwicklung Und Wachstum Von Unternehmen - Geologie Der Landschaft Um Wien - Die Rechenmaschinen Von Konrad Zuse - Spinal Cord Monitoring And Electrodiagnosis - Hochfrequenztechnik In Funk Und Radar - Funktionale Grammatik Und Sprachbeschreibung - Die Selbstbeobachtungsfalle - The Crack Tip Opening Displacement In Elastic-plastic Fracture Mechanics - Young Urban Poor - Im Zeichen Des Umbruchs - Allgemeine Elektrotechnik - Anleitung Zur Entwicklung Elektrischer Starkstromschaltungen - Insulin - Korruption Risikofaktor Mensch - Verlufe - Soziologische Gegenwartsdiagnosen Ii - Anorganisch-nichtmetallische Werkstoffe - Pathophysiology Of Shock Sepsis And Organ Failure - Betriebskosten Und Organisation Im Baumaschinenwesen - Rekonstruktion Von Vergangenheit - Die Auswirkungen Der Nachhaltigkeitsberichterstattung Auf Den Kapitalmarkt - Rntgendiagnostik Der Leber - Krebsforschung In Deutschland - Acute Peripheral Vascular Surgery - Politikwissenschaftliche Spiegelungen - Kunst Und Religion Der Mayavlker Ii - Systemtheorie Und Gender - Functional Morphology Of Neuroendocrine Systems - Jenseits Des Rationalen Handelns - External Environmental Costs Of Electric Power - Multilokales Wohnen - Politische Bildung Und Geschlechterverhltnis - Organisation Formen Und Modelle - Germanistik Als Wissenschaft - Geometric Structure Of High-dimensional Data And Dimensionality Reduction - Rassismus Wider Willen - Pr-beratung In Der Politik - Modellierung Der Welt - Lehrbuch Des Stahlbetonbaues - Adapting Historical Knowledge Production To The Classroom - 28th International Symposium On Shock Waves - Landwirtinnen - Lebendige Krfte - Das Praktische 1—1 Der Pr - Die Messung Hoher Temperaturen - Global Denken Global Gewinnen - Algebraic Structures - Anton Dohrn - Arsenic And Rice - Korrelationssignale - Rckfall In Die Barbarei - Leichtbaustatik - Cardiac Valve Allografts 19621987 - Urbane Bden - Nichteheliche Lebensgemeinschaften - Organizational Politics - Agricultural Project Management - Die Flechten Deutschlands - Surgical Research Recent Concepts And Results - Organizational Ambidexterity - Linguistik Im Internet - Baustatik - Englische Weltpolitik In Englischer Beleuchtung - Verhandlungsdemokratie - The Collagens Biochemistry And Pathophysiology - Orale Photochemotherapie - Die Satzrdersysteme Der Evolventenverzahnung - Frankreich Und Das Vereinigte Deutschland - Investmentrecht - Aktuelle Theoriediskurse Sozialer Arbeit - Nonresponse In Bevlkerungsumfragen - Vertrauen In Organisationen - Wechselmodell Psychologie Recht Praxis - Entwicklung Der Offenen Jugendarbeit In Wolfsburg - Artificial Heart 3 - Kreativitt Und Krankheit - Identitten In Der Modernen Welt - Grundkurs Web-programmierung - Krise Und Einkommen - Recent Developments In Applied Demand Analysis - Handbuch Handel - Kompendium Der Augenheilkunde - Vermgen In Sicherheit - Rechnungslegung Steuerung Und Aufsicht Von Banken - Friedensstrategien - Assessment Of Cell Proliferation In Clinical Practice - Doping Dokumente - Die Kohlenwasserstoff-synthese Nach Fischer-tropsch - Die Schiffsexpedition - Theorien Und Methoden In Den Sozialwissenschaften - Viruses Of Lower Vertebrates - Alfred Andersch - Kundennutzen Die Basis Den Verkauf - Ein Haus Ein Aufruhr - Entscheidungen In Der Individualisierten Gesellschaft - Atlas Of Interstitial Cells Of Cajal In The Gastrointestinal Tract - Die "wissensgesellschaft" - Der Praktische Maschinenzeichner - –ko-audits Nach Der Verordnung Der Eu - Der Soziologische Blick - Investitionsrechnung - Arbeiter Unternehmer Professioneller - Allgemeines Und Gaskatalyse - Der Gestaltete Lernkontext - Telepublishing - Digital Control Systems - The European Union And Member State Territories A New Legal Framework Under The Eu Treaties - Hazards To Drinking Water Supplies - Intracranial Pressure Vii - Attributgrammatiken - Implementation Politischer Programme Ii - Das Glaukom - Hausfamilien - Entwerfen Und Berechnen Der Dampfturbinen - Die Krisis Des Deutschen „rztestandes - Employability And Mobility Of Bachelor Graduates In Europe - Informationsbedarf Und Informationsinstrumente Des Betrieblichen Emissionsmanagements - Technischer Lehrgang Starterbatterien - Meywert-analyse - Instandhaltung - Wohnen Im Wandel - Handwrterbuch Zur Gesellschaft Deutschlands - Nichtlineare Stabstatik - Lehrbuch Der Mathematik - Kostenrechnung 2 - Psychoanalyse Im Kontext - Computational Mechanics 95 - Leben In Benachteiligten Wohngebieten - Deutschland Als Neue Heimat - Psychoanalyse In Der Weiterbildung - Plastomechanik Der Umformung Metallischer Werkstoffe - Wind Energy - Friedrich List Deutschlands Grosser Volkswirth - Familienformen Im Sozialen Wandel - Lehrbuch Der Allgemeinen Tierzucht - Clinical Measurement In Coloproctology - Practical Approaches To Alcoholism Psychotherapy - Multiprozessorsysteme - Differenzierungsfolgen - Heimat In Zeiten Erhhter Flexibilittsanforderungen - Transformationsprozesse In Deutschland - Wie Aus Ideen Bilder Werden - Quantum Mechanics Using Maple - Internationale Professionalitt - Das Leuchten Der Organismen I - The Dermal Lymphatic Capillaries - Grundlagen Und Mathematische Hilfsmittel Der Hochfrequenztechnik - Der Internationale Rechtsschutz Der Patente Muster Warenzeichen Und Des Wettbewerbes - Epidemiology And Biology Of Multiple Myeloma - Rationelle Energieverwendung Im Hochbau - Persnliche Netzwerke In Stadt Und Land - Vom Fachexperten Zum Wissensunternehmer - Der Wrmebergang Und Die Thermodynamische Berechnung Der Leistung Bei Verpuffungsmaschinen Insbesondere Bei Kraftfahrzeug-motoren - Qualitative Chemische Analyse - Integrated Pollution Control - Anders Wirtschaften - Was Erfolgreiche Besser Machen - Freies Skizzieren Ohne Und Nach Modell Maschinenbauer - Mediamatik Die Konvergenz Von Telekommunikation Computer Und Rundfunk - Die Filterung Der Atemluft Und Deren Bedeutung Staubkrankheiten - Beleuchtungsalgorithmen In Der Computergrafik - Kommunale Strategien Gegen Massenarbeitslosigkeit - Chinese Drugs Of Plant Origin - Analysis - Arbeitsbuch - Georg Von Siemens Ein Lebensbild Aus Deutschlands Groyer Zeit - Die Grund- Und Endprobleme Der Erkenntnis - Die Bank Der Zukunft - Akademische Lehrsttten Und Lehrer Der Oto-rhino-laryngologie In Deutschland Im 20 Jahrhundert - Stufen Zur Akademisierung - Methoden Und Modelle Des Operations Research - Manipulatorpraxis - Witterung Und Klima - Wie Lernt Die Politik - Molecular Electronics - 3d-kino - Handbuch Der Evaluationsstandards - Sepsis - Geothermal Fluids - The Nuclear Shell Model - Dbase Iv Einsatz In Lokalen Netzwerken Lan - Next Economy - Human Physiology - Randelementmethoden - River Dynamics And Integrated River Management - Emotionen Sozialstruktur Und Moderne - Cardiomyopathies - Gastroenterologische Endoskopie Anleitung Die Praxis - Schillerpromenade 27 12049 Berlin Ein Haus In Europa - Die Cdu - C++ Toolbox For Verified Computing I - New Macromolecular Architecture And Functions - Pattern Recognition And Machine Learning - Furniere Sperrholz Schichtholz - Der Sdosten Verkehrspolitisch Betrachtet - Retinal Detachment Surgery - Einhrung In Die Erziehungswissenschaft - Einhrung In Die Digitale Signalverarbeitung - Kritik Der Lebenswelt - Ausgewhlte Untersuchungsverfahren In Der Metallkunde - Gabler Lexikon Vertrieb Und Handel - Leitfaden Der Mechanik Maschinenbauer Mit Zahlreichen Beispielen Den Selbstunterricht - Biomedizinische Technik 4 - Die Abenteuer Des Anselm Wytegern - Die Wechseljahre Des Mannes - Funktionen Einer Vernderlichen - Magnetic Resonance And Related Phenomena - Erfolgsorientierte Gesprchshrung - Intelligent Transportation And Evacuation Planning - Towards A New Map Of Automobile Manufacturing In Europe - Die Radikalisierte Moderne - Histology Of Ancient Human Bone Methods And Diagnosis - Die Grundlagen Der Raumkhlung - 27 Kongrey Der Deutschen Gesellschaft Soziologie Gesellschaften Im Umbruch - A Practical Guide To Human Cancer Genetics - Psychodrama - Geschichte Der Rbe Beta Als Kulturpflanze - Remote Sensing An Operational Technology For The Mining And Petroleum Industries - Heat Shock - Colitis Ulcerosa Adenomatosis Coli - Handbuch Tauchunflle - Transportation For The Future - Humankologie Und Kulturkologie - Abfallentsorgung Im Ausland - Die Eisenkonstruktionen - Rckreise In Die Vergangenheit - Atlas Of Transesophageal Color Doppler Echocardiography And Intraoperative Imaging - Hydrotherapie Im Hause Des Kranken - Bevlkerungswissenschaft Quo Vadis - Spezielle Chirurgische Diagnostik - Informationssysteme Hochschulen - Die Gleichheit Der Geschlechter Und Die Wirklichkeit Des Rechts - Strategieorientierte Unternehmensbewertung - Electronic Banking Im Vertrieb - Mathematik Wirtschaftsingenieure Und Naturwissenschaftlich-technische Studiengnge - Lehrbuch Der Chirurgie Und Orthopdie Des Kindesalters - Magnetic Recording Handbook - Grundlagen Der Eigenspannungen - Adnexal Tumors Of The Skin - Die Klinik Der Entschdigungspflichtigen Berufskrankheiten - A Short Textbook Of Physics - Der Hrer In Die Flechtenkunde - Das Tornado-phnomen - Messungen In Fluvialen Systemen - Die Gonorrhoe Des Weibes - Hhere Mathematik Ingenieure Band Ii - Philosophie Und Hrung - Bemessungstafeln Eisenbetonkonstruktionen - Strahlenschutz An Beschleunigern - Die Technik Der Blutgruppenuntersuchung Kliniker Und Gerichtsrzte - Die Atomionen Chemischer Elemente Und Ihre Kanalstrahlen-spektra - Ankerwicklungen Gleich- Und Wechselstrommaschinen - Vertigo - Leitsymptom Schwindel - Der Fabrikbetrieb - Spasticity - Clientserver-technologie In Der Unternehmenspraxis - Begriffsbildung Und Theoriestatus In Der Friedensforschung - Macht In Unternehmen - Hepatocellular Carcinoma And Liver Metastases Diagnosis And Treatment - Ingenieurmechanik 2 - Hydrotherapie Elektrotherapie Massage - Erfolgsfaktor Rechnungswesen - Brckenbausysteme Mittelgroye Spannweiten - Sdafrika - Die Internationale Bauausstellung Emscher Park - Application Of Structural Systems Reliability Theory - Die Nahaufnahme - Die Berechnung Verankerter Hngebrcken - Die Berechnung Von Gleich- Und Wechselstromsystemen - Molekl-origami - The Neurobiology Of Motivation And Reward - Ideologien In Der Weltpolitik - Mathematische Modellierung - Wertbewusstes Controlling - Ertragstafeln Reine Und Gleichartige Hochmaldbeftnde Von Eiche Buche Tanne Fichte Kiefer Grner Douglafie Und Lrche - Neue Anstze Im Kulturmanagement - Die Entwicklung Des Soziologischen Wissens - „ertragt Mich Dass Ich Rede - Koalitionen In West- Und Osteuropa - Das Konzept Der Metropolregion In Theorie Und Praxis - Heilen Und Bilden - Politik Und Nichtpolitik - Essential Psychology - Professionell Telefonieren - Dictionary For The Glass Industry Fachwrterbuch Die Glasindustrie - Koalitionen Und Koalitionsvereinbarungen - Die Fortschrittsfalle - Die Praxis Des Eisenhttenchemikers - Application Development Systems - Kulturvergleichende Psychologie - Differential Games - Software-entwurf In Pearl-orientierter Form - Strategische Vertriebssteuerung - Navigating In Educational Contexts - Long-term Studies In Ecology - Erneuerung Der Politik „von Unten - Konstruktionslehre Des Allgemeinen Maschinenbaues - Arbeiten Aus Dem Zahnrztlichen Institut Der Universitt Breslau - Trennung Von Molekularen Mischungen Mit Hilfe Synthetischer Membranen - 300 Jahre Deutsch-japanische Beziehungen In Der Medizin - Endourology - Akkreditierung Als Mikropolitik - Bildung Im Cyberspace - Interessen Ideen Und Institutionen - Auf Der Suche Nach Thrill Und Geborgenheit - Ausschreibungshilfe Haustechnik - Managementorientiertes It-controlling Und It-governance - Stem Cells And Human Diseases - Soziales Kompetenztraining - Lehrbuch Der Zeitgemyen Vorkalkulation Im Maschinenbau - Anleitung Zu Den Physiologischen œbungen - Nutrition Diet And Cancer - Die Person Als Organon In Der Sozialen Arbeit - Percutaneous Transluminal Angioscopy - Jenseits Des Films - Rheumaorthopdie Untere Extremitt - Interpretative Sozialforschung - Buchhrung Der Kreditinstitute - Allein Unter Frauen - Reaktivierungsmanagement Von Not Leidenden Unternehmen - Konferenzen Professionell Organisieren - Schrder Gegen Stoiber - Peripheralization - Digital Audio Restoration - Prfungsvorbereitung Groy- Und Auyenhandelskaufleute - Buchhrung Und Bilanzierung - Nacktheit - Netzwerk Weltpolitik - Grundlagen Der Leistungselektronik - Das Bonner Bundeskanzleramt - Grundlagen Des Ingenieurholzbaus - Proceedings Of An International Conference On Dynamic Crack Propagation - Prediction Markets - Beyond The One Room School - Variable Vergtung Im Vertrieb - Reformierung Des Gesundheitssystems Oder In Welchem Gesundheitssystem Wollen Wir Leben - Management Und Controlling Von Softwareprojekten - Grundzge Der Technischen Schwingungslehre - Alkohol Und Volksgemeinschaft - Das Walzen Von Hohlkrpern Und Das Kalibrieren Von Werkzeugen Zur Herstellung Nahtloser Rohre - Berliner Szenetreffpunkt Bahnhof Zoo - The Endocrine Control Of The Fetus - Beitrge Zur Jugendforschung - Politische Strategieanalyse - Tumormarker - Superfine Particle Technology - Graph Data Model - Konstruktion Und Kritik - Sicherheit In Der Unsicheren Gesellschaft - Das Telephon Und Sein Werden - Die Halbierte Gesellschaft Der Postmoderne - Kreativitt Und Form - Markenpsychologie - –kologische Linguistik - Die Logik Des Politikwissenschaftlichen Experiments - Die Gemeinntzige Gmbh - Funkkolleg Altern 1 - Die Rechtssichere Abmahnung - Hrer Durch Die Elektrizittswirtschaft - Ethics And Compliance Programs In Multinational Organizations - Grundriss Der Physik Nach Dem Neuesten Stande Der Wissenschaft - Demokratie Und Verfassung An Den Grenzen Des Wachstums - Informationskontexte Massenmedien - Karl Mannheims Analyse Der Moderne - Risiko Gesundheit - Ein Lehrbuch Der Botanik - Professionelle Vertriebspower Im Maschinen- Und Anlagenbau - Contemporary Research In Engineering Science - Politische Integration - Die Organischen Katalysatoren Und Ihre Beziehungen Zu Den Fermenten - Sexual Plant Reproduction - Unerwartete Todesflle In Klinik Und Praxis - Pisa 2000 - Einfluyfelder Orthogonal Anisotroper Platten Influence Surfaces Of Orthogonal Anisotropic Plates - Energieeinsparverordnung - Geldanlage Und Steuer 1999 - Synthetische Soziologie - Network Relationship Management - Experimental Psychology Cognition And Human Aging - Arbeiten Der Lehrkanzel Tierzucht An Der Hochschule Bodenkultur In Wien - –konomie Der Nachhaltigkeit - Verfahrenstechnische Grundlagen Der Lebensmitteltechnik - Cim Lexikon - Staat Und Technische Kommunikation - Perspektiven Der Germanistik - Die Restrukturierung Des Arbeitsmarktes - Migrne - A Guide To Addiction And Its Treatment - Diagnostic Evaluation Of The Knee - Stahlbau 2 - Grundriss Der Histologie Und Mikroskopischen Anatomie Des Menschen - Transgenic Mice And Mutants In Mhc Research - Staat Markt Und Rente In Der Internationalen Politik - Cerebral Blood Flow - Protokolle Der Volkskammer Der Deutschen Demokratischen Republik - Mikrobiell Verursachte Endokarditis - Das Kreisdiagramm Der Induktionsmotoren - Geographie Die Verkehrswirtschaft - Benzodiazepines And Therapeutic Counselling - Gefahr –kosysteme Und Wasserqualitt - Dynamisches Finanzmanagement In Der Praxis - Psychophysics In Action - Soziale Netze Und Soziale Untersttzung Alleinerziehender Frauen - Berufs- Und Karriereplaner Erneuerbare Energien - Aussagefhigkeit Und Aussagewilligkeit Von Probanden Bei Der Conjoint-analyse - Chemisorption Und Ionisation In Metall-metall-systemen - Organisieren Und Organisationen Verstehen - Sanierung Von Metallbauteilen - Aus Der Frhzeit Der Eisenbahnen - Static And Dynamic Analyses Of Plates And Shells - Die Ganz Alltgliche Gewalt - Erster Unterrieht Des Jungen Drogisten - Advances In Oceanography - Unternehmen Unix - Lebensversicherungsmedizin - Einhrung In Die Physik - Katalog - Funktionssysteme Der Gesellschaft - Nicht-numerische Informationsverarbeitung - Fluidik - Wirtschaftslehre Den Bankkaufmann - Die Zuckerkrankheit Und Ihre Behandlung - Beyond The Pale - Politikberatung Parteien - Perspektivenbernahme - Sicherheit In Freiheit - Principles Of Bone Regeneration - Handbook On Hyperbaric Medicine - Die Regiebetriebe Der Gemeinden - Umweltgerechte Energiepolitik - Der Harn Sowie Die Brigen Ausscheidungen Und Krperflssigkeiten Von Mensch Und Tier Ihre Untersuchung Und Zusammensetzung In Normalem Und Pathologischem Zustande - Ethnischer Radikalismus - Neue Jugendbiographie - Modern Treatment Of Severe Burns - Analytische Und Prparative Labormethoden - Druck Von Textilien - Marktwirtschaften Unter Dem Druck Globalisierter Finanzmrkte - Die Genfer Scheckrechtsabkommen - Einhrung In Die Probleme Des Elektrischen Lichtbogen- Und Widerstandsofens - Programmieren In C++ Borland-versionen - Tauchtechnik - Fernsehen Und Hrfunk Die Demokratie - Die Elektromotoren In Ihrer Wirkungsweise Und Anwendung - Die Berechnung Des Selbstkostenpreises Der Gewebe - Platow Prognose 2011 - Elementare Geometrie Und Algebra - The Protistan Cell Surface - Berechenbarkeit Und Unlsbarkeit - Vom Leben Zum Erleben - Grundkurs Programmieren Mit Delphi - Die Neue Kommunikationswissenschaft - Die Theorie Elastischer Gewebe Und Ihre Anwendung Auf Die Berechnung Biegsamer Platten - Hat Soziale Arbeit Ein Politisches Mandat - Geschichten Aus Livius Mit Ergnzungen Aus Griechischen Schriftstellern - Clinical In Vitro Fertilization - Im Umgang Mit Der Macht - Data Fusion Concepts And Ideas - Aus Forstlicher Theorie Und Praxis - Information Theory And Best Practices In The It Industry - Der Arzt Am Krankenbett - Concurrency And Nets - Betablocker Im Neuen Jahrtausend - Reputation In Der Mediengesellschaft - Wind Energy 19751985 - The Pathology Of The Endocrine Pancreas In Diabetes - Anatomie Und Physiologie Der Holzpflanzen - Variationsrechnung - Bevlkerungsentwicklung In Ostdeutschland - Solar Energy Conversion - Statistische Thermodynamik - Lehrmeister Whrungskrise! - Methods In Protein Sequence Analysis - Circles Of Support - Die Logik Der Marke - Die Ersten 25 Jahre Der Deutschen Gesellschaft Chirurgie - Architektur Mit Dem Computer - Der Weg Zu Weltinnovationen - Handbook Of Recording Engineering - Nation Und Nationale Identitt - Echo-planar Imaging - Utleon3 Exploring Fine-grain Multi-threading In Fpgas - Document Architecture In Open Systems The Oda Standard - Geologie Und Radioaktivitt - Social Skills - Methods Theories And Empirical Applications In The Social Sciences - Aachener Bausachverstndigentage 2008 - Desintegrationsdynamiken - Federlegierungen Aus Ne-metallen - Zuknftige Entwicklungen In Der Mobilitt - Mensch Und Lebensraum - Handbuch Medienselbstkontrolle - Interkulturelles Personalmanagement - Medical Textiles For Implantation - Business Process Modelling - Wie Vorhersagbar Sind Grundschulnoten - Elektrotherapie - Merkmale Und Reprsentationen - Mobile Payment - Stadtentwicklung Gotha 19902000 - Selbstorganisation Kooperation Zeichenprozey - Dynamic Policies Of The Firm - Leistung Und Weg - Lernfeld Europa - Perception And Motor Control In Birds - Geochemistry Of Sedimentary Ore Deposits - Berufs- Und Karriere-planer Chemie - Electron Spin Resonance Esr Applications In Organic And Bioorganic Materials - Die Eigenschaften Elektrotechnischer Isoliermaterialien In Graphischen Darstellungen - Akkulturation Von Migrantinnen - Die Fdp - Schulverweigerung - Technische Zivilisation - Late Reconstructions Of Injured Ligaments Of The Knee - Physik Des Ultraschalls - Tragwerkselemente - Menschenkenntnis Verkufer - Structure And Change In The Space Economy - Sozialer Wandel In Ostdeutschland - Ausbildungsreife - Second Quantized Approach To Quantum Chemistry - Beginning Android Adk With Arduino - Basic And Clinical Research On Renal Cell Carcinoma - Hormone Des Ovariums Und Des Hypophysenvorderlappens - Statistik Informatik Und –konomie - Lexikon Der Soziologischen Werke - Marktberlegenheit Und Persnliche Effizienz - Dokumentenakkreditivgeschft - Interstellar Magnetic Fields - Das Waagerecht-bohr- Und Frswerk Und Seine Anwendung - Der Knstliche Pneumothorax - Einheit Und Freiheit - Nutritional Management Of Cancer Treatment Effects - Parteien Im Wandel - Soziale Zeit Und Biographie - Fern-sehen Im Alltag - Lebensqualitt - Kritische Differenzen Geteilte Perspektiven - Praxiswissen Presse- Und –ffentlichkeitsarbeit - Grundbegriffe Der Ganztagsbildung - Die Wirtschaftliche Lage Von Kanada - Der Steinkohlenbergbau Des Preussischen Staates In Der Umgebung Von Saarbrcken - Grenzen Virtueller Gemeinschaft - Planeten Wanderer Im All - Statik Und Dynamik Der Schalen - Helicobacter Pylori 1990 - Distributed Systems - Treibstoffe Verbrennungsmotoren - Das Traumatische Apallische Syndrom - Streitbare Demokratie Und Innere Sicherheit - Grundlagen Qualittsmanagement - Alltagsrationalitt In Der Nachrichtenrezeption - Optimale Industriestandorte - Die Bodenmechanik In Der Baupraxis - Ergebnisse Der Biologie - Bildungs- Und Erziehungskatastrophe - Allokationseffizienz In Der Rechtsordnung - Die Submikroskopische Anatomie Und Pathologie Der Lunge The Submicroscopic Anatomy And Pathology Of The Lung - Entstehung Von Kooperationsfhigkeit - Politik Als Lernprozess - Der Risikodiskurs - Economic Transformation In Eastern Europe And East Asia - Begriffe Besetzen - Die Wohlfahrtspflege - Journalismus Als Kultureller Prozess - Die Beratene Gesellschaft - Bildungsgerechtigkeit Jenseits Von Chancengleichheit - X Und Motif - Deutschland In Den Neunziger Jahren - Analytische Und Numerische Methoden Der Feldberechnung - Angewandte Gestalttheorie In Psychotherapie Und Psychohygiene - Grundriss Der Entwicklung Des Menschen - Chiral Separations - Das Finanz- Und Haushaltssystem Der Europischen Union - Industrielle Keramik - Weck Den Sieger In Dir! - Nuclear Medicine Imaging An Encyclopedic Dictionary - Living With Paradoxes - Politische Diskurskulturen In Europa - Metallurgische Elektrochemie - Acamprosate In Relapse Prevention Of Alcoholism - Aggregation And Representation Of Preferences - Hefe Und Alkohol Sowie Andere Grungsprodukte - Statistik-œbungen - Gemischt-ganzzahlige Optimierung Modellierung In Der Praxis - Der Harnsure- Zystin- Xanthin-stein - Ambulantes Blutdruckmonitoring - Ct And Mri Of Disk Herniations - Das Wesen Der Erfindung - Internationaler Vertrieb - Circulation And Contaminant Fluxes In The North Sea - Berechnungen Konstruktionsgrundlagen Und Bauelemente Spanender Werkzeugmaschinen - Frakturen Und Luxationen - Lust Auf Leistung - Recent Developments In Mathematical Physics - Ist Die Erlebnisgesellschaft In Chemnitz Angekommen - Grundriss Der Gesundheitssorge - Der Grundbau - Jugendliche Maghrebinischer Herkunft Zwischen Stadtpolitik Und Lebenswelt - Programmieren In Smalltalk Mit Visualworks - Fortschritte Der Elektrokardiologie 1963 Und 1964 - Das Sterreichische Bergschadenrecht Unter Bercksichtigung Des Deutschen Bergrechtes - Lernkompetenzen An Hochschulen Frdern - Neue Herausforderungen Im Personalmanagement - Evolutionary Biology - Akzeptanz - Steuerung Von Privatisierung - Constitutive Modelling In Geomechanics - Radiometrie - Verhandeln Und Argumentieren - Der Contrapunkt - Kulturpdagogik - Sich Gesund Hlen Im Jahre 2000 - Guicciardinis Kritik An Machiavelli - Die Institutionenordnung Der Ddr - Expert Systems In Engineering Applications - Digitale Signalverarbeitung - Die Herzogthmer - Die Grundgesetze Der Wrmebertragung - Cardiac Glycoside Receptors And Positive Inotropy - Faszination - Generalisierte Lungenparenchymerkrankungen - Die Elektrischen Ausrstungen Der Gleichstrombahnen Einschlieylich Der Fahrleitungen - Bericht Ber Die Nfzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1934 - Staat Und Globalisierung - Auf Dem Weg Nach Europa - Human Lactation 2 - Werbung Mode Und Design - Anleitung Zur Niederschrift Und Verffentlichung Medizinischer Arbeiten - Lehrbuch Der Funktionentheorie - Helminthology - Die Berechnung Der Anlay- Und Regelwiderstnde - Das Selbst Im Netz - Was Determiniert Wortstellungsvariation - Die Strukturkrise Der Strukturpolitik - Grundlagen Der Chemotherapie - Iron Metabolism - Einhrung In Die Regelungstechnik - Die Transintentionalitt Des Sozialen - Betriebseinrichtungen Der Textilveredelung - Imaging Techniques Of The Cns Of The Neonates - Die Isolierstoffe Der Elektrotechnik - Handbuch Sekretariat - Interdisziplinre Risikoforschung - Die Behandlung Der Geschwlste Nach Dem Gegenwrtigen Stande Und Den Ergebnissen Der Experimentellen Forschung - Jugend Vor Der Moderne - Leadership Branding - Aufbereitung Metallischer Sekundrrohstoffe - Geschlechtsspezifische Ungleichheit Im Erwerbsverlauf - Assisted Circulation 3 - Grundlagen Der Schmalfilmtechnik - Robotersysteme 1 - Das Heilbad Wiesbaden - Der Deutsche Bund Oder Ob Gotha Ob Bamberg - Das Ja Zur Politik - Vom Obrigkeitsstaat Zur Entgrenzten Politik - Die Enttuschten Revolutionre - Michel Foucault Pdagogische Lektren - Families Schools And Delinquency Prevention - Das Republikanische Europa - Kernverfahrenstechnik - Mit Branding An Die Spitze! - Mammo-t - Topics In Applied Quantumelectrodynamics - Leveraged Buyouts - Der Wandel Nach Der Wende - Erfolgsfaktor Ich - Kreativitt Und Improvisation - Reef Diagenesis - Programmierkurs Turbo-pascal Version 70 - Was Hlt Gesellschaften Zusammen - Von Pascal Zu Assembler - Gespaltene Jugend - Acta Historiae Neerlandicaestudies On The History Of The Netherlands Vi - Grundriss Der Suglings≈ Und Kleinkinderkunde - Die Eisenbahn - Transportsteuer Und Ihre Stellung Im Staatshaushalte - Autocad Grundkurs - Berufsausbildung In Der Ddr - Management And More - Lectures On Developmental Physiology - Kunstglieder Und Orthopdische Hilfsmittel - Die Dampfturbinen Mit Einem Anhange Ber Die Aussichten Der Wrmekraftmaschinen Und Ber Die Gasturbine - 100 Jahre Schiffbautechnische Gesellschaft - Zukunft Der Arbeit Und Geschlecht - Der Bauratgeber - Schub Und Torsion In Geraden Stben - Betriebskosten Der Verschiebebahnhfe - Demographie Und Wohlstand - The Embryo - Pflanzensoziologie - Der Elastisch Drehbar Gesttzte Durchlaufbalken Durchlaufende Rahmen Gebrauchsfertige Zahlen Einfluylinien Und Grytwerte Der Momente - Von Geheimen Politikmachern Und Wissenschaftlichen Hoflieferanten - Diabetes Mellitus - Soziologische Abenteuer - –konomie Der Werbung - Das Politische Organisationsfeld - Telekommunikation Und Jugendkultur - Dynamics And Interactions Of Galaxies - Diagnostic Imaging Of The Nose And Paranasal Sinuses - Das Politische System Der Bundesrepublik Deutschland Im Kontext - Skriptum Informatik - Alle Wege Hren Zum Menschen - Korrupte Demokratie - Interessen Und Institutionen In Der Internationalen Politik - Zwischen Anpassung Und Konfrontation - Sharing Expertise Als Kern Von Wissensmanagement - Pharmazeutische Informationssysteme - Angewandte Atomphysik - Die Digitalis Und Ihre Therapeutische Anwendung - Die Pathogenen Protozoen Und Die Durch Sie Verursachten Krankheiten - Betoninstandsetzung - Exzellenz Im Dienstleistungsmarketing - Nachhaltige Quartiersentwicklung - Qualitatives Forschen In Der Erziehungswissenschaft - Anker Und Ankerungen Zur Stabilisierung Des Gebirges - Verlust Der Sicherheit - Calcium In Muscle Contraction - Der Herzinfarkt - Neue Lebensstile In Der Arbeiterschaft - Atrioventricular Conduction In Congenital Heart Disease - Informierte Grndungsfrderung - Lebenserinnerungen - Der œbergang In Die Sekundarstufe I - Liebe Zwischen Ehre Und Engagement - Handbuch Der Schutzimpfungen - A Practitioners Guide To Prescribing Antiepileptics And Mood Stabilizers For Adults With Intellectual Disabilities - Handbuch Parteienforschung - Aufgaben Zum Skriptum Informatik - Die Constantinische Schenkungsurkunde - Parteien Und Whler Im Umbruch - Carbid Und Acetylen - Keine Panik Vor Ingenieurmathematik! - Programmieren In Prolog - Tourismus Im Lndlichen Raum - Tierische Sozialarbeit - Equilibrium And Kinetics In Contact Metamorphism - Tricad Ms - Der Dimorphismus Der Wahrheit - Zivilisationswende - Meyverfahren Der Experimentellen Mechanik - Kardiale Rhythmusstrungen - Distributionslogistik - The Future Of Muon Physics - Hiv Betroffene Und Ihr Umfeld - Anleitung Zur Bestimmung Von Mineralien - Diskurs-inszenierungen - Aesthetic And Reconstructive Otoplasty - Plastische Chirurgie Am Auge - Hilfsbuch Dampfmaschinen-techniker - Stoffwechsel Und Energiewechsel - Lebertumoren Und Portale Hypertension - Schmaus Grundriss Der Pathologischen Anatomie - Die Umworbene Gesellschaft - Maschinenuntersuchungen - Agrar-–ko-audit - Zukunftsfeld Dienstleistungsarbeit - Der Verkehr Mit Arzneimitteln Und Giften Ausserhalb Der Apotheken - Statik Der Stabtragwerke - Lexikon Der Pflanzlichen Fette Und –le - Physik Mit Dem Pc - Der Das Unendliche Kannte - Lehrbuch Der Zahnrztlichen Kronen- Und Brckenprothetik - Dekonstruktive Pdagogik - Grundriss Der Pharmaceutischen Chemie - Cad Werkzeug Des Architekten - Biochemisches Taschenbuch - Die Knochengeschwlste - Kreiselpumpen - Festschrift Die Wirklichkeit - Die Entstehung Von Groyeisenindustrie An Der Deutschen Seekste - Stdtische Verkehrsplanung - Beitrge Zur Angewandten Wirtschaftsforschung - Umweltbewuytsein Und Alltagshandeln - Individuum Und Krankheit - Professionalitt Sozialer Arbeit Und Hochschule - Vito Volterra - Riskante Strategien - Software Process Automation - Ultrasound Of Appendicitis - Ozon - Kriegsschiffbau - Atlas On The Biology Of Soil Arthropods - Kasuistische Beitrge Zur Modernen Pharmakotherapie Mit Quetiapin - Innovation Resources And Economic Growth - Leitfaden Der Humangenetik - Handbuch Freie Journalisten - Flucht Vor Dem Gewissen - Auswahl Von Standard-applikations-software - Der Effiziente Staat Fiktion Oder Vision - Materia Medica Of New And Old Homeopathic Medicines - Wie Weit Ist Der Weg Nach Deutschland - Derivative Spectrophotometry And Electron Spin Resonance Esr Spectroscopy For Ecological And Biological Questions - Psychische Krankheit Im Alter - Bewegungstherapie In Der Kardiologie - Technik- Und Wissenschaftsethik - Alles Was Sie Ber Marken Wissen Mssen - Schule Mit Zukunft - Soziale Inklusion - Wie Ich Pluto Zur Strecke Brachte - Solution Chemistry Of Surfactants - Grundkurs Knstliche Intelligenz - Angewandte Mathematik Insbesondere Informatik - Advances In Human Genetics - Blutdruck Unter Krperlicher Belastung - Strmungsmaschinen - Life Under Extreme Conditions - Variation-aware Design Of Custom Integrated Circuits A Hands-on Field Guide - Website Marketing - Das Kontroll- Und Transparenzgesetz - Ingenieure - Aufgaben Und Lsungen Aus Der Gleich- Und Wechselstromtechnik - A Dictionary Of Real Numbers - Die Entwicklung Der Kausalitt Im Kulturvergleich - Bodenkologie Mikrobiologie Und Bodenenzymatik Band I - Multinationals In The New Europe And Global Trade - Textile Faserstoffe - Vwl Berufsschulen - Die Entwicklung Des Verkehrs - Remote Sensing Digital Image Analysis - Einhrung In Die Elektrizittslehre - Internationale Umweltregime - Der Frser Als Rechner - Atomkraft - Der Eisenbeton-schiffbau - Stent-implantationen Und Vaskulre Mr-diagnostik - Gemeinntzigkeitsrecht Soziale Einrichtungen - Zukunftssicherung Die Bauwirtschaft - Politik Und Gedchtnis - Mnnergewalt Gegen Frauen Beenden - Projekt- Und Investitionscontrolling Mit Sap R3 - Verbrennungskraftmaschinen - Treatment Of Cerebral Infarction - Freiheit Wovon Freiheit Wozu - Die Transformation Kulturellen Kapitals - Kundennutzen Die Anwendung Im Verkaufsgesprch - Pro C 50 And The Net 45 Framework - Recombinant Human Erythropoietin Rhepo In Clinical Oncology - Die Wissenschaftlichen Grundlagen Des Rundfunkempfangs - Ergebnisse Der Immunittsforschung Experimentellen Therapie Bakteriologie Und Hygiene - Entkriminalisierung - Controlling Mit Sap - Die Ffentliche Begrndung Politischen Handelns - Theorie Rationalen Handelns - Quantenfeldtheorie Des Festkrpers - Betriebswirtschaftslehre Der Industrie - Abfallwirtschaft Stoffkreislufe - Die Medizin An Der Berliner Charit© Bis Zur Grndung Der Universitt - Kinder- Und Jugendarmut In Deutschland - Parteien In Osteuropa - Magnetic Reconnection - Fernsehaneignung Und Alltagsgesprche - Neue Wege Der Betrieblichen Planung - Die Stromversorgung Von Fernmelde-anlagen - Die Rechtskunde Des Ingenieurs - Die Chemisch-technischen Untersuchungs-methoden Der Zellstoff- Und Papier-industrie - Demokratie Und Demokratiemessung - Handeln In Einer Hungerkrise - Qualittsmanagement In Der Praxis - Hla In Narcolepsy - Programmprofile Kommerzieller Anbieter - Komplikationsmanagement Im Herzkatheterlabor - Die Generation Der Wende - Huser - Risk Management - Chemical Mutagenesis In Mammals And Man - Der Eva Als Management- Und Bewertungsinstrument - Liebeserklrungen - Cruise Management - Das Konstrukt „bevlkerung Vor Im Und Nach Dem „dritten Reich - Deutschland In Einer Neuen Weltra - Einhrung In Die Theorie Der Schwachstromtechnik - Pollution Of The North Sea - Prozess- Und Projektmanagement Itil - Armut Und Zeit - Mediengeschichte Und Kulturelle Differenzierung - Die Prfung Der Elektrizittszhler - Mediensoziologie - Patch Testing And Prick Testing - Elektrotechnisches Praktikum - Kultur Und Wirtschaft - Mensch Maschine Megabyte - Organisation Der Content-produktion - Fluorescence Spectroscopy - Grundriy Der Ernhrungslehre - Pathways In Applied Immunology - Leistungsgerechte Vergtung Verkaufsteams - Metal Ions In Neurological Systems - Risk Behaviour In Adolescence - Fachrechnen Elektroberufe - At1-rezeptorblockade - „warum Haben Sie Eigentlich Streit Miteinander - Die Untersuchung Und Beurteilung Des Wassers Und Des Abwassers - Heterogenitt - Diversity - Intersektionalitt - Infant Feeding - Umweltorientierte Materialwirtschaft - Migration Und Schulischer Wandel Leistungsbeurteilung - Ordnungstheorie Und Ordnungspolitik - Elektronenmikroskopische Methodik - Erfolgreich Akquirieren - Schadstoffe In Elektrischen Und Elektronischen Gerten - Ciprofloxacin Iv - Selbstorganisation Und Public Value - Anonymitt Im Internet - Individualisierung Und Integration - Methodology Ecological Genetic And Nutritional Effects On Growth - Screening Des Prostatakarzinoms - Materials In Marine Technology - Computational Fluid Dynamics - Taking Your Ipad To The Max Ios 5 Edition - New Advances In Computer Graphics - Hhere Mathematik Ingenieure - Entwicklungspsychologie Des Jugendalters - Fallsammlung Wirtschaftslehrewirtschaftsrechnen - Essentielle Spurenelemente In Der Nahrung - Hans J Morgenthau Und Der Weltpolitische Realismus - Haustechnik Im Wohnungsbau - Baukosten Bei Neu- Und Umbauten - Erfolgreiche Datenbankanwendung Mit Sql3 - The Hla System In Clinical Transplantation - Whrungsrisiken Im Portfolio - Kulturelle Grundlagen Der Medialisierung In Sdkorea - Parteien Und Parteimitglieder In Der Region - Explosive Shocks In Air - Sprachspiel Metapher - Versicherungswirtschaftslehre - Abriss Der Dauermagnetkunde - Teilhabe An Der Gesellschaft - Jahrbuch Soziologiegeschichte 1991 - Grundlegung Eines Verbandssteuerrechts - Taking Action In Science Classrooms Through Collaborative Action Research - Persnlichkeit Und Subjektivitt - Die Deutsche Seefischerei - Gabler Mlp Berufs- Und Karriere-planer It Und E-business 20062007 - Ostmitteleuropa Ruyland Und Die Osterweiterung Der Nato - Waldhumusdiagnose Auf Biomorphologischer Grundlage - Trinkwasser Und Abwasser In Stichwrtern - Interaktionsplattformen Und Kundenintegration In Industriegtermrkten - Auge Und Allgemeinerkrankungen - Wozu Braucht Man Demokratie - Physik In Formeln Und Tabellen - Die Goldwhrung - Epidemiological Practices In Research On Small Effects - Die Wrmewirtschaft In Der Zellstoff- Und Papierindustrie - Die Corporate Social Responsibility-politik Der Europischen Kommission - Elektrische Messung Mechanischer Gryen - Das Reduktionsverfahren Der Baustatik - Learn Cocos2d Game Development With Ios 5 - Pflege Im Wandel Gestalten Eine Hrungsaufgabe - Advances In Superconductivity Iii - Wohlfahrtspluralismus - Konstruieren Gestalten Entwerfen - Erluterungen Zu Den Vorschriften Elektrische Bahnen Bahnvorschriften - Pre-mesozoic Geology In The Alps - Transformation Der Verbndedemokratie - –kologisch Planen Und Bauen - Glaucoma Update Iv - Elemente Der Dritten Gruppe - Hilfsbuch Nahrungsmittelchemiker Zum Gebrauch Im Laboratorium Die Arbeiten Der Nahrungsmittelkontrolle Gerichtlichen Chemie Und Anderen Zweige Der Ffentlichen Chemie - Supply Chain Excellence Im Handel - Handbook Of Neurochemistry - Turbulent Shear Flows 6 - Die Zukunft Des Journalismus - Die Asynchronen Wechselfeldmotoren - Nutzen Und Gefahren Der Therapie Mit Benzodiazepinen - Kanzler Und Minister 2005 - 2013 - Analytische Und Konstruktive Differentialgeometrie - œber Zahlen Und Spiele - Motivanalyse Zu Anwenderinnovationen In Online-communities - Der Edisonakkumulator - Die Ablsung Und Regelung Der Waldgrundgerechtigkeiten - Ein Jahrhundert Deutscher Maschinenbau - Bildung Als Bedrohung - Sozialpolitik Und Sozialstaat - Elektrisches Kochen - Septischer Abort Und Bakterieller Schock - Grammatik Und Sprachverarbeitung - Die Suglingstuberkulose In Lbeck - Growth Hormone And Somatomedins During Lifespan - Sonographie Des Kindlichen Hftgelenks - One-to-one- Marketing Im Internet - Migration Und Integration In Berlin - Die Entstehung Des Neuen In Der Adoleszenz - Muscle Transplantation - Die Internet-galaxie - „text-tollhaus Bachmann-schtige - 22 Deutscher Soziologentag 1984 - Die May- Und Gewichtsordnung - Jahrbuch Der Preuyischen Forst- Und Jagdgesetzgebung Und Verwaltung - Politik Medien Technik - How Institutions Change - Visions And Strategies In European Integration - Knftige Lebenswege Von Schulkindern - Das Moralische In Der Soziologie - Das Messen Mit Elektrischen Gerten - Einhrung In Die Arbeitstechniken Der Politikwissenschaft - Zugnge Die Fixateur-externe-osteosynthese - Ausschreibungshilfe Ausbau - Geschlechtsrollen Stabilitt Oder Wandel - Jugendkriminalitt - Grundriss Der Klinischen Stuhluntersuchung - Ich Hab Mehr Das Gesprch Gesucht - Die Vertragsmssige Doppelwhrung - Die Technik Und Der Krieg - Particle Physics And Astrophysics Current Viewpoints - Grundbildung Kaufleute - Hair Research - Tradition Und Transformation - Theory Of Production And Cost - Studienhrer It An Fachhochschulen - Isostasie Und Schweremessung - Chemisch-botanischer Leitfaden Zollbeamte - Outdoor-training - Surgical Anatomy And Technique - Ethisches Marketing In Psychologie Und Psychotherapie - Kriegsdiskurse - Direktmarketing Mit Kundendaten Aus Bonusprogrammen - Anteil Der Konstruktion Und Des Materials An Dem Wirtschaftlichen Ausbau Niederer Wasserkraft-geflle Mit Besonderer Bercksichtigung Der Verhltnisse An Der Ruhr - Einhrung In Die Festkrperphysik - Untersttzung Der Unternehmensentwicklung Junger Wachstumsorientierter Technologieunternehmen Durchventure Capital-gesellschaften In Der Betreuungsphase - Innovationen Im Mittelstand Erfolgreich Managen - Die Dreidimensionale Ultraschalldiagnostik - Die Leistungssteigerung Von Groydampfkesseln - The Impact Of Performance Budgeting On Public Spending In Germanys Laender - Jahresbericht Ber Die Beobachtungs - Ergebnisse - Transurethral Surgery - Kernmagnetische Resonanz - Sitzhaltung · Sitzschaden Sitzmbel - Gelbsucht - Kompetenz Undoder Zustndigkeit - Konfliktlotsen In Dienstleistungsunternehmen - New Developments For Limb Salvage In Musculoskeletal Tumors - Foundations Of Differential Geodesy - Bewegungs- Und Krperorientierte Anstze In Der Sozialen Arbeit - Das Elektrische Kabel - Welfare And Efficiency In Public Economics - Zerkleinerungs- Und Klassiermaschinen - Georg Von Siemens - Politische Steuerung Im Wandel Der Einfluss Von Ideen Und Problemstrukturen - Wahlen In Postsozialistischen Staaten - Die Statik Des Ebenen Tragwerkes - Die Entzndliche Grundlage Der Typischen Geschwurs Bildung Im Magen Und Duodenum - Common Dilemmas In Family Medicine - Ifrs Kleine Und Mittelgroye Unternehmen - Diathermie Heissluft Und Knstliche Hhensonne - Das Glas Im Chemischen Laboratorium - Lehrbuch Der Mikrochemie - Interdisziplinre Managementforschung Und -lehre - Groykessel-feuerungen - Organisationale Zusammenschlsse Im Nonprofit-bereich - Reliability Evaluation Of Power Systems - Kesselbetrieb - Theatermanagement - „lterwerden Im Betrieb - Frankreichs Privat- Und Handelsrecht - Der Wirkungsgrad Von Dampfturbinen Beschauflungen - Bestallungsordnung „rzte Und Prfungsordnung Zahnrzte - Ein Biychen Feministisch Anwendungsorientierte Sozialforschung - Musik Als Utopie - Internalisierung Und Strukturbildung - Friedensprozess Im Nahen Osten - Das Rztliche Gutachten - Recent Advances In Management Of Digestive Cancers - Negative Hermeneutik - Diurese Und Diuretica Diuresis And Diuretics - Hydraulik Bauingenieure - Schlsseltechnologie-industrien - Direktmarketing Aus Erster Hand - Wirtschaftliche Entwicklung Bei Schrumpfender Bevlkerung - Travel Medicine - Seelenleben Und Menschenbild - Publizieren Whrend Der Promotion - Literatur Und Journalismus - Eine Verfassung Die Europische Union - Sucht Und Familie - Tron Project 1989 - Grundlagen Der Technischen Thermodynamik - Economic And Financial Knowledge-based Processing - Symbole Der Politik Politik Der Symbole - Milk Proteins - Die Geburt Der Eltern - Grundkurs C++ In Beispielen - Introduction To Robotics - Institutional Partnerships In Multi-hazard Early Warning Systems - Ontogeny Cell Differentiation And Structure Of Vascular Plants - New Frontiers In Cytology - Gynkologische Operationstechnik - Interkulturelle Handlungskompetenz - Climate Earth Processes And Earth History - Global Problems And Common Security - Die Trockene Destillation Des Holzes - Die Przisionsbestimmung Von Gitterkonstanten Nach Der Asymmetrischen Methode - Atomic Physics Of Highly Charged Ions - Perspektiven Der Kognitiven Linguistik - Aktuelle Ther