Welcome to Striped

A free, fully responsive HTML5 site template by HTML5 UP

July 14, 2014

Expertenwissen - Bank- Und Finanzwirtschaft - Der Kationen- Und Wasserhaushalt Des Mineralbodens - Politische Institutionalisierung Und Konflikttransformation - Regionale Wirtschaftspolitik Im Kooperativen Bundesstaat - Estriche Und Bodenbelge - Kriminalitt Und Sicherheitspolitik - Die Wasserheizung - Kreditsicherheiten - Bericht œber Den Leobener Bergmannstag - Enterprise Wikis - Sensory Evaluation Of Food - Grundzge Der Praktischen Pharmazie - Advances In Human Genetics 11 - Plasmaphysik Und Fusionsforschung - Die Gewinnung Von Erdl Mit Besonderer Bercksichtigung Der Bergmnnischen Gewinnung - Internationale Kommunikation - Pre-mesozoic Geology In The Alps - Real-world Problems For Secondary School Mathematics Students - Die Pubertt - Methods Of Protein And Nucleic Acid Research - Angewandte Soziologie - Berufsbildungspolitik - Travel Medicine - Jahrbuch Soziologiegeschichte 1991 - Deutschland Nach Der Wende - Active Oxygen In Biochemistry - Brauchen Wir Einen Neuen Gesellschaftsvertrag - Unfallforschung Unfallmechanik Und Unfallrekonstruktion - Fremdenfeindlichkeit Als Medienthema Und Medienwirkung - Geschichte Des Landes Sachsen-anhalt - Gabler Lexikon Marketing - Methods Theories And Empirical Applications In The Social Sciences - Leybold Vakuum-taschenbuch - Transport- Und Lagerlogistik - Epidemiology And Biology Of Multiple Myeloma - Erworbene Schriftsprachstrungen - Handbuch Spezielle Soziologien - Remote Service Technology Perception And Its Impact On Customer-provider Relationships - Numerische Mathematik Ingenieure - Bauphysikalische Aufgabensammlung Mit Lsungen - Stahlrohrkonstruktionen - Einhrung In Die Mechatronik - Das Politische Organisationsfeld - Schizophrenia - Eigentumsvorbehalt Und Abzahlungsgeschft - Digitaltechnik - Migration Sprache Und Kulturelles Kapital - Finite Element Analysis For Heat Transfer - Der Knstliche Pneumothorax - Surgery Of The Skull Base - Klimatische Behandlung Innerer Krankheiten - Ditetik Der Stoffwechselkrankheiten - Werke - External Environmental Costs Of Electric Power - Jugendkonsum Im Internationalen Vergleich - Unternehmensbewertung Und Potentialanalyse - Die Operative Technik Des Tierexperimentes - Familienbildung In Deutschland - Neukundengewinnung Durch Dialogkommunikation - Friedenspolitik In Und Europa - Identittsfalle Oder Weltbrgertum - Frakturen Und Luxationen - Demokratie Auf Dem Prfstand - C Net Mit Methode - Hochfrequenz- Und Lasertechnik In Der Medizin - Professionalitt Und Alltag In Der Erziehungsberatung - Datenbertragung Nachrichtentechnik In Datenfernverarbeitungssystemen - The Neuropathology Of Hiv Infection - Management Of Oesophageal Carcinoma - „pleite Glotzt Euch An Restlos - Metabolic Reactions In The Nervous System - Der Westliche Universalismus - Neues Europa Alte Eu - Normativitt In Der Kommunikationswissenschaft - Jugendkriminalitt - Mitarbeiter Im Auslandseinsatz - Soziale Konstruktionen - Die Optischen Instrumente - Nahost Jahrbuch 1990 - Computer Graphics 1987 - First Leaves A Tutorial Introduction To Maple V - Markenmanagement - Sicher Auftreten Im Technischen Vertrieb - Grundzge Der Beleuchtungstechnik - Die Treibmittel Der Kraftfahrzeuge - Medienwandel Als Wandel Von Interaktionsformen - Die Gesellschaftlichen Folgen Der Medienkonzentration - Das Praktische 1—1 Der Pr - Die Denkform Der Alternative In Der Jurisprudenz - Theorie Der Medizinischen Informatik - Alex - Algebraische Algorithmen - Umweltbewuytsein - In Der Sprache Der Tter - Elementare Baustatik Studium Und Praxis - Bausteine Einer Systemischen Nachrichtentheorie - Eigenwilligkeit Und Rationalitt Sozialer Prozesse - 100 Minuten Den Kompetenten Auftritt - Chemisch-botanischer Leitfaden Zollbeamte - Kulturelle Grundlagen Der Medialisierung In Sdkorea - Radikaler Antisemitismus - Praxis Der Angiologischen Diagnostik - Freche Verse Physikalisch - Die Elliptischen Funktionen Von Jacobi - Enterprise Networks And Telephony - Nondestructive Evaluation Of Materials By Infrared Thermography - Kulturwissenschaftliche Hermeneutik - Aufgaben Zur Elektrotechnik Maschinenbauer - Sdafrika - Mittelstandsanleihen - Controlling Mit Sap - Die Macht Des Kunden Und Wie Sie Ihn Trotzdem Kriegen - Generalisierte Tendomyopathie Fibromyalgie - Geschlechtsrollen Stabilitt Oder Wandel - Whrungsoptionen - Die Neue Radikale Rechte Im Vergleich - Zerkleinerungs- Und Klassiermaschinen - Vom Ornament Zum Nationalkunstwerk - Recent Contributions To Fluid Mechanics - Soziologie Als Oppositionswissenschaft - Die Statik Im Stahlbetonbau - City-management - Lehren Und Lernen In Der Beruflichen Erstausbildung - Cim Integration Und Vernetzung - C A Bjerknes - Augenerkrankungen Im Kindesalter - Analytische Und Projektive Geometrie Die Computer-graphik - Frieden Und Sicherheit Im 21 Jahrhundert - Management Von Spitzenqualitt - Logic And The Organization Of Information - Sampling Of Powders And Bulk Materials - Evolutionr Hren - Der Steinkohlenbergbau Des Preussischen Staates In Der Umgebung Von Saarbrcken - Einhrung In Die Betriebswirtschaftslehre - Efficiency Institutions And Economic Policy - Elektronen- Und Ionen-strme - Diskursanalyse Von Verkaufsgesprchen - Die Dynamik Der Selbststeuerung - Kulturen Vergleichen - Qualittsmanagement In Non-profit-organisationen - Die Gaserzeuger - Wohlfahrtspluralismus - Joint Surgery Up To Date - Innovative Regulierung - Boom-branchen 50plus - Kaffee Und Koffein - Neurosecretion - Prfungsvorbereitung Kaufleute Brokommunikation - Regieren In Der Bundesrepublik Iv - Organisations-intelligenz Iq - Mathematik Volks- Und Betriebswirte - Beginning Database Design - Metabolic Turnover In The Nervous System - Kompetenz Undoder Zustndigkeit - „rzte Briefe Aus Vier Jahrhunderten - Informationsbedarf Und Informationsinstrumente Des Betrieblichen Emissionsmanagements - Lehrbuch Der Waldwertrechnung Und Forststatik - Software-as-a-service - Konstruktion Digitaler Systeme - Die Praxis Der Physikalischen Therapie - Effektives Compliance Management In Unternehmen - Recht Bankfachwirte - Basement Correlation Across The North Atlantic - Brgerschaftliches Engagement - Aktiengesellschaft Und Holdinggesellschaft In Der Schweiz Geltendes Recht Und Revision - Stahlbau 1 - Lexikon Statistik - Interkulturelles Personalmanagement - Motive Und Weiterbildungsbedarf - Grundzge Der Bergbaukunde Einschliesslich Aufbereitung Und Brikettieren - Soziale Arbeit Als Transdiziplinre Wissenschaft - Akademiker-arbeitslosigkeit - Expert Systems In Environmental Planning - Hllen-inszenierung „wrestling - Der Zeitzhlertarif - Candida Albicans - Pro Aspnet Mvc 4 - Cad Referenzmodell - Design And Simulation Of Spectrum Management Methods For Wireless Local Area Networks - Nutrition And Behavior - The Best Of [email protected] - Eine Frau Und Die Mathematik 19331940 - Drehstrommotoren Mit Doppelkfiganker Und Verwandte Konstruktionen - Tauchtechnik - Aktuelle Herausforderung In Der Gefychirurgie - Atlas Der Positronen-emissions-tomographie Des Gehirns Atlas Of Positron Emission Tomography Of The Brain - Stichproben-verfahren In Der Umfrageforschung - Bauplanung Mit Din-normen - Co2 Laser Surgery - Treibstoffe Verbrennungsmotoren - Die Erkrankungen Der Blutdrsen - War Der Wissenschaftliche Kommunismus Eine Wissenschaft - Comparative Mammalian Cytogenetics - Advancing The Technology Of Bileaflet Mechanical Heart Valves - Verrechnungspreise Zwischenprodukte - Hallgeneratoren - Hochfrequenzmesstechnik - Der Gmbh-geschftshrer - Demokratie Lernen In Berlin - Das Trockengleichrichter-vielfachmeygert - Miyverstndnisse In Gesprchen - Hat Soziale Arbeit Ein Politisches Mandat - Hydrologie - Grundlegung Eines Verbandssteuerrechts - Gefahr –kosysteme Und Wasserqualitt - Schwingungen - Fruchtwechsel In Der Forstwirtschaft - Kurze Geschichte Der Katalyse In Praxis Und Theorie - Brckenbausysteme Mittelgroye Spannweiten - Sozialer Wandel In Den Neuen Bundeslndern - Einhrung In Die Methoden Der Sozialwissenschaftlichen Religionsforschung - Magnetospheric Physics - Pro Spring Mvc With Web Flow - Der Gleislose Erdbau - Publikums- Und Wirkungsforschung - Total Hip Arthroplasty - Aufgaben Physikalische Schlerbungen - Statik Und Dynamik Der Schalen - Urologie Die Praxis - Prozeyorientierte Unternehmensorganisation - Bergschadenkunde - Chirurgische Knochen- Und Gelenkerkrankungen - Handbuch Der Modellstatik - Eisenguy In Dauerformen - The Digital Control Of Systems - Die Garnverarbeitung - Reflectance Spectroscopy - Systemtheorie Und Neue Soziale Bewegungen - Die Pathologisch-histologischen Untersuchungsmethoden - Der Harn Sowie Die Brigen Ausscheidungen Und Krperflssigkeiten Von Mensch Und Tier Ihre Untersuchung Und Zusammensetzung In Normalem Und Pathologischem Zustande - Investment Fonds - Grundzge Der Physik - Korrosionstabellen Nichtmetallischer Werkstoffe Geordnet Nach Angreifenden Stoffen - Schriftspracherwerb - Knee Surgery - Politik Als Lernprozess - Modeling And Managing Shallow Lake Eutrophication - Insulin - Vollmachten Im Unternehmen - Mobilisierung Alle - Building Global Security Through Cooperation - Packetc Programming - A Solution To The Riddle Dyslexia - Die Suglingstuberkulose In Lbeck - Das Kreditgeschft In Der Abschluyprfung Von Bankkaufleuten - Algorithms For Graphics And Image Processing - Angeborene Herzfehler - Atlas Of Peripheral Nerve Ultrasound - Elektrische Maschinen Der Kraftbetriebe - Transparenz In Arbeitsorganisationen - Angewandte Statistik - Selbst- Und Fremdzuschreibungen Im Kontext Von Europa - Liebeserklrungen - Frontiers In Computer Graphics - Turbo Pascal Version 60 - Arbeitsphysiologie Ii Orientierung Plastizitt Stimme Und Sprache - Heilen Forschen Interaktion - Keine Angst Vor Dem Finanzamt - Elektromagnetische Strahlungsfelder - Integrationspdagogik Und Geschlecht - Die Technik Des Orthopdischen Eingriffs - Kernreaktortheorie - Die Abenteuer Des Anselm Wytegern - Basic-wegweiser Ibm Pc Pc Xt Portable Pc Und Pcjr - Lehrbuch Der Chirurgischen Krankenpflege - Einhrung In Die Differential- Und Integralrechnung Nebst Differentialgleichungen - Die Bankgehilfenprfung In Programmierter Form - Internationales Steuerrecht - Bildungserfahrungen An Montessorischulen - The Taxation Of Capitalistic Bequests - Klinische Pathophysiologie Der Atmung - Die Landwirtschaftliche Verwertung Stdtischer Abwsser - Platow Prognose 2012 - Introduction To Mathematical Logic - Puk - Soziale Identitten Jugendlicher - An Outline Of Neurosurgery - Wie Die Medien Die Wirklichkeit Steuern Und Selber Gesteuert Werden - Aesthetic And Reconstructive Otoplasty - Kommunikationsberatung Und Kommunikationstraining - Funktionentheorie - Rntgendiagnostik Im Kindesalter - Wer Heiratet Wen - Handbuch Politische Gewalt - Geisteswissenschaften Und Wissenschaftspolitik An Der Schwelle Zum Dritten Jahrtausend - Kartellrecht In Der Unternehmenspraxis - Arbeitswissenschaft Im Nationalsozialismus - Musik Als Utopie - Nuclear Imaging Of The Chest - Proceedings Of The Fourth Conference On Origins Of Life - Patient Krankenhaus - Logistikkostenrechnung - Gabler Wirtschaftswrterbuch Russisch - Schlsselwerke Der Systemtheorie - Solidaritt - Anleitungen Zum Arbeiten Im Elektrotechnischen Laboratorium - Beyond The Pale - Klinik Und Atlas Der Chronischen Krankheiten Des Zentralnervensystems - Statistische Methode Die Zuverlssigkeitsanalyse - Caryophyllales - Frauen Und Rechtsradikalismus In Europa - Afrika Jahrbuch 2003 - Das Finanz- Und Haushaltssystem Der Europischen Union - Bilanzierung Von Pensionsverpflichtungen - Stress - Einschwingvorgnge Gegenkopplung Stabilitt - Chefinnen - Kommunikation Im Corporate Change - Schauderhaft Banales - Tourismus Im Lndlichen Raum - Der Beruf Des Chirurgen - Right Hemisphere Contributions To Lexical Semantics - Krise Und Einkommen - Mobilfunknetze - Kommunikationswissenschaft Im œberblick - Lebensstile Im Sozialstrukturellen Kontext - River Dynamics And Integrated River Management - Verkehrsformen Und Schreibverhltnisse - Orphan Lung Diseases - Die Taxation Maschineller Anlagen - Gynkologie Und Geburtshilfe 1990 - Learning Democracy In School And Society Education Lifelong Learning And The Politics Of Citizenship - Handbuch Der Psychosozialen Intervention - Physiotherapeutisches Rezeptierbuch - Leitfaden Der Bewegungsbestrahlung - Die Meywandler - Coordination Chemistry In Non-aqueous Solutions - Markt-management - Das Prometheus-projekt - Hyperurikmie Gicht Und Andere Strungen Des Purinhaushalts - Geschftsmodelle Quadruple Play - Rahmentragwerke Und Durchlauftrger - Principles Of Statistical Radiophysics 3 - Hren In Schwierigen Zeiten - Baubetriebspraxis - Facebook Und Co - Berufs- Und Karriere-planer Chemie - Materials In Marine Technology - Gesellschaft Und Tiere - Das Gestaltproblem - Generationen Eines Jahrhunderts - Katalog - Komplexe Zahlen Und Zeiger In Der Wechselstromlehre - Hchstdruckdampf - Entwicklungs- Und Bewegungsphysiologie Der Pflanze - Milde Hypertonie Und Leichte Fettstoffwechselstrungen - Kapital Und Kompetenz - Unterschiedlich Verschieden - Lehrbuch Der Drahtlosen Telegraphie - Interaction Between Mental And Physical Illness - Aufstze Zur Deutschen Revolution - Gerichtsrztliche Untersuchungen - Distributed Systems - Die Verhaltenstherapeutische Behandlung Des Stotterns - Geschichte Der Erwachsenenbildung In Deutschland - Proceedings Of The Third Conference On Origins Of Life - Dv-projektrecht - Die Maschinenzlle In Den Wichtigsten Kulturstaaten Der Welt Nach Dem Stande Vom 1 Januar 1908 - Demokratische Perspektiven In Der Pdagogik - Riskante Entscheidungen Und Katastrophenpotentiale - Die Schiffsexpedition - Das Rztliche Gutachten Im Versicherungswesen - Geschichten Aus Livius Mit Ergnzungen Aus Griechischen Schriftstellern - Hre Dich Selbst - Lehrbuch Der Pflanzenkrankheiten - Spte Mtter - Chemie Des Waffen- Und Maschinenwesens - Praxis Der Psychodramatischen Supervision - Sprache Migration Und Schulfachliche Leistung - Kontinuumsschwingungen - Groyeltern In Europa - Politik Diesseits Der Macht - Handbuch Geotechnik - Chemie Und Chemische Technologie Radioaktiver Stoffe - Die Wirtschaftlichkeit Als Konstruktionsprinzip Im Eisenbetonbau - Gatt Negotiations And The Political Economy Of Policy Reform - Situationsklrungen - Geschichte Der Bergbau- Und Httentechnik - Antisemitismus In Der Bundesrepublik Deutschland - Innovative Logistik - Gas Flow And Chemical Lasers - Constructional Morphology And Evolution - Die Globale Agenda - Die Apparatfrberei Der Baumwolle Und Wolle Unter Bercksichtigung Der Wasserreinigung Und Der Apparatbleiche Der Baumwolle - Methoden Der Empirischen Gruppentherapieforschung - Fuchs-aktuell Vermgensmanagement Mit Etfs - Unbewuyte Selbstbilder - Ankerwicklungen Gleich- Und Wechselstrommaschinen - Limb Salvage - Jugendkonsum Im 21 Jahrhundert - Critical Levels In The Development Of Natural Systems - Klnge Und Gerusche - Industrial Crystallization - Theorie Ideal Plastischer Krper - Advances In Genetics Development And Evolution Of Drosophila - Oxidative Injury In Dermatopathology - Kostenrechnung 1 - Buchhrung Der Kreditinstitute - Bau Groyer Elektrizittswerke - Bergbaumechanik - Ausbildungskompass Bankkaufleute - Bericht Ber Die Xxii Tagung Kriegstagung - Stufen Zur Akademisierung - Integrative Biological Psychiatry - Vieweg Lexikon Technik - Money - Alltgliche Lebenshrung - Informationsableitung In Betrieblichen Anwendungssystemen - Grundzge Der Elektrotechnik - Feldanalyse Als Forschungsprogramm 1 - Jahrbuch Der Schiffbautechnischen Gesellschaft - Arbeitsorganisation Und Neue Technologien - Spielregeln Den Umgang Mit Chefs - Blcke Und Kokillen - Advanced Robotics 1989 - Die Unsichtbare Hand Im Unternehmen - Stochastische Prozesse - Bttcherforberg Technisches Zeichnen - Radio - Aufstand Der Palstinenser Die Intifada - Die Zukunft Europas - Das Tornado-phnomen - Diskriminierung - Jugendbilder - Bussysteme In Der Automatisierungs- Und Prozesstechnik - Parteien - Die Wissenschaftliche Und Angewandte Photographie - Medien - Codes - Menschmaschinen - Das Politische System Der Ukraine - Frakturen Auf Einen Blick - Stimulated Cerebral Blood Flow - Building A Data Warehouse - Die Berechnung Des Symmetrischen Stockwerkrahmens Mit Geneigten Und Lotrechten Stndern Mit Hilfe Von Differenzengleichungen - Konstruktion Und Kritik - Abb Der Tanzende Riese - Prediction Markets - Praxis Des Customer Relationship Management - Grundlagen Der Hrung - Hyperparathyreoidismus - Gerechtigkeit - Die Stille Macht - Die Fabrikation Der Kartoffelstrke - Die Untersuchung Der Arzneimittel Des Deutschen Arzneibuches 6 - Die Abderhaldensche Reaktion - Die Cdu - Einfluss Von Steuern Auf Unternehmerische Entscheidungen - Der Rationelle Getreidebau - Endothelial Mechanisms Of Vasomotor Control - Zwischen Sozialer Verantwortung Und Konomischer Vernunft - Die Krackverfahren Unter Anwendung Von Druck Druckwrmespaltung - Management Und Controlling Von Softwareprojekten - Aachener Bausachverstndigentage 2003 - Pathophysiology Of Shock Sepsis And Organ Failure - „rger In Organisationen - Lehrbuch Des Obstbaus Auf Physiologischer Grundlage - Emotionen Sozialstruktur Und Moderne - Sap Erp - Praxishandbuch Projektmanagement - Nordrhein-westfalen Und Die Europische Gemeinschaft - Vob Bildband - Der Urknall - Maschinen- Und Anlagendiagnostik - Organisation Strukturwandel Und Arbeitsmarktmobilitt - Geldanlage Mit Optionen Und Futures - Grundzge Einer Physiologie Und Klinik Der Psychophysischen Persnlichkeit - Internal Fixation Of Small Fractures - Deutsche Identitt Und Das Zusammenleben Mit Fremden - Bioastronomie - Wertewandel - John Charnley - Die Finanzierung Und Bilanz Wirtschaftlicher Betriebe - Praxiswissen Umweltfreundliches Bauen - Propan-butan - Hhere Analysis Mit Derive - Useful Plants Of Neotropical Origin - Analyse Extraterrestrischen Materials - Verbundtrger - Aachener Bausachverstndigentage 2002 - Crystal Pulling From The Melt - Surgery Of The Stomach - Alternative Investments Verstndlich Verkaufen - Ipod Touch Made Simple Ios 5 Edition - Brennstoff Und Verbrennung - In Der Schule - Berichte Des Ausschusses Versuche Im Eisenbau Ausgabe B - Buchhrung Und Jahresabschluy - Grundlagen Des Ingenieurholzbaus - Kompendium Weiterbildung - Altersbilder In Der Wirtschaft Im Gesundheitswesen Und In Der Pflegerischen Versorgung - Knstliche Organische Farbstoffe Und Ihre Zwischenprodukte - The Physical Chemistry Of Membranes - Wasserbau Und Wasserwirtschaft In Deutschland - Politische Eliten In Slowenien Und Makedonien - Achtzehnjhrige Zwischen Reaktion Und Rebellion - Tuberkulose Im Kindesalter - Politikberatung Parteien - Musikmobile Kulturarbeit Und Populre Musik - Climate Earth Processes And Earth History - Politische Steuerung Durch Sanktionen - Qualitativ-empirische Sozialforschung - Einhrung In Die Empirische Literaturwissenschaft - Die Universitt Heidelberg Und Die Geburt Der Modernen Wissenschaft - Die Kretinische Entartung - –konomische Probleme Des Zivilrechts - Kommentar Krperschaftsteuer Kstg - Kloster Und Abt - Wissenschaftliche Weiterbildung Als Transformationsprozey - Die Hollndische Landwirtschaft - Die Zukunft Der Werbeagenturen - Atomkraft - The Embryology Of The Human Locomotor System - Die Ergebnisse Der In Den Preussischen Staatsforsten Ausgehrten Anbauversuche Mit Fremdlndischen Holzarten - Interaktives Fernsehen - Lebenslufe Hben Und Drben - Investment Confidence And Business Cycles - Herz- Und Kreislauferkrankungen Im Alter - Bildung Nach Plan - Bildungsautonomie Zwischen Regulierung Und Eigenverantwortung - Immune Consequences Of Trauma Shock And Sepsis - Kardiale Rhythmusstrungen - Von Adenauer Zu Schrder Der Kampf Um Stimmen - Adaptiogenese Und Phylogenese - Die ‚erbpolizei‛ Im Nationalsozialismus - Handeln In Einer Hungerkrise - Lehrbuch Der Kinderkrankheiten - Hyperion Terra Incognita - Die Inventur - Soziologie In Pdagogischen Kontexten - Grundriss Der Entwicklungsgeschichte Des Menschen - Fragrances - The Crack Tip Opening Displacement In Elastic-plastic Fracture Mechanics - Technology Acceptance In Education - Die Verbesserung Des Menschlichen Zusammenlebens - Forest Decline And Atmospheric Deposition Effects In The French Mountains - Interregional Migration - Gewaltdarstellungen In Den Medien - Wirtschaftsprfung - Physikalische Medizin Balneotherapie Und Rehabilitation Im Hheren Lebensalter - Illustrated C 2012 - Transformation Der Verbndedemokratie - Strategic Retail Management - Phytopharmaka Ii - Sap Apo In Der Praxis - Portal Hypertension - Kultur Und Wirtschaft - Edi-knigge - Handbook On Hyperbaric Medicine - Anatomie Und Physiologie - Vom Leben Zum Erleben - Die Flotation In Theorie Und Praxis - Handbuch Medienarbeit - Grundlagen Elektrischer Maschinen Und Antriebe - Algorithmen Zur Gefyerkennung Die Koronarangiographie Mit Synchrotronstrahlung - Starthilfe Elektrotechnik - Der Lastkraftwagenverkehr Seit Dem Kriege Insbesondere Sein Wettbewerb Und Seine Zusammenarbeit Mit Den Schienenbahnen - Die Logik Direkter Demokratie - Nation Als Form - Pseudopotentiale - Cytology In Gynecological Practice Gynkologische Vitalzytologie In Der Praxis - Sekretariatskunde Mit Edv - Bindungsverlust Und Zukunftsangst Leben In Der Risikogesellschaft - Old-economycom - Sozialkologie - Grundlagen Und Rechenverfahren Der Elektrotechnik - Traditionales Denken Und Modernisierung - Biological Coherence And Response To External Stimuli - Percutaneous Transluminal Angioscopy - Publizieren - Lineare Algebra Mit Mathematica Und Maple - Vorlesungen Ber Statik Und Festigkeitslehre - Grundbildung Kaufleute - Die Verhtung Von Gesundheitsschdigungen Durch Anklopfmaschinen Die Verhtung Der Anklopferkrankheit - Aggregation And Representation Of Preferences - Derivate Arbitrage Und Portfolio-selection - Small Bowel Radiology - Fernsehen - Gewalt Und Geschlecht - Metamorphosen Der Technik - Die Bedeutung Europas In Der Auyenpolitik Der Usa - Die Verwsserung Von Erdlfeldern Ihre Ursachen Und Bekmpfung - Aktiv Und Konsequent Hren - Soziologie Der Kommunikationsmedien - Bilanzanalyse Und Bilanzkritik - Einwanderungsdiskurse - Managementorientiertes It-controlling Und It-governance - Die Niederspannungs- Und Hochspannungs-leitungsanlagen - Entwicklung - Die Syntax Des Tempus - Marktwirtschaften Unter Dem Druck Globalisierter Finanzmrkte - Gesenkschmiede - Die Waldstreu Und Ihre Bedeutung Boden Und Wald - Die Entzndliche Grundlage Der Typischen Geschwurs Bildung Im Magen Und Duodenum - Transportmanagement - Stochastic Optimal Control And The Us Financial Debt Crisis - Costs And Benefits In Health Care And Prevention - Learn Cocoa Touch For Ios - Kommunale Strategien Gegen Massenarbeitslosigkeit - Kinderarmut Und Generationengerechtigkeit - Das Framing Von Issues In Medien Und Politik - Das Glaukom - Lehr- Und Lernkompetenz Erwerben - Die Drahtseile - Die Ernhrung Gesunder Und Kranker Kinder „rzte Und Studierende Der Medizin - Spezielle Chirurgische Diagnostik - Ausgewhlte Chirurgisch-klinische Krankheitsbilder - Altern Ein Lebenslanger Prozey Der Sozialen Interaktion - Inference For Diffusion Processes - Future Of Civil Society - Wrterbuch Der Kraftbertragungselemente Diccionario Elementos De Transmisi³n Glossaire Des Organes De Transmission Glossary Of Transmission Elements Glossario Degli Organi Di Trasmissione Glossarium Voor Transmissie-organen Ordbok Fr Transmissionselement Voimansiirtoalan Sanakirja - Die Maschinenelemente - Handbuch Bildungsforschung - Zwischen Anarchie Und Strategie - Unix Systemverwalter - Grundkurs Programmieren Mit Delphi - Lebensthemen Junger Frauen Die Andere Vielfalt Weiblicher Lebensentwrfe - Politische Sozialisation In Der Ddr - Bericht Ber Den Viii Allgemeinen Deutschen Bergmannstag Zu Dortmund Vom 11 Bis 14 September 1901 - Lehrbuch Der Nomographie - Liming Of Acidified Surface Waters - Finite Dimensional Algebras - Expertinnen Machen Schule - Werbe- Und Konsumerziehung International - Gewerkschaften Im Umbau Des Sozialstaats - Die Chemie Der Bau- Und Betriebsstoffe Des Dampfkesselwesens - Verlufe - Foundations Of Differential Geodesy - Lehrbuch Der Thermochemie Und Thermodynamik - Technische Messungen Bei Maschinenuntersuchungen Und Zur Betriebskontrolle - Handbuch Der Physik - Wirtschaftsfrderung Und Kommunalpolitik - Wandel Von Der Telekommunikation Zu Unified Communications - Long-term Studies In Ecology - Molecular Basis Of Membrane-associated Diseases - Der Wirtschaftliche Charakter Der Technischen Arbeit - Dynamischer Wettbewerb - Bauelemente Und Grundschaltungen - Infant Feeding - Modern Techniques In Computational Chemistry Moteccâ„¢ -89 - Photoelasticity - Zugnge Die Fixateur-externe-osteosynthese - Tidal Deposits - Tumours Of The Female Lower Genital Tract - Beitrge Zur Jugendforschung - Anleitung Zur Untersuchung Der Lebensmittel - Management Gurus - Essener Beitrge Zur Empirischen Wirtschaftsforschung - Das Wachstum Des Kindes - Die Isolierstoffe Der Elektrotechnik - Die Rekonstruktion Ostmitteleuropas - Die Registrierung Des Herzschalles - Fehler Und Fehlerschutz In Elektrischen Drehstromanlagen - Diffuse Scattering Of X-rays And Neutrons By Fluctuations - Dft - Diskrete Fourier-transformation - Der Geologische Aufbau –sterreichs - Denklchrift Ber Das Ffentliche Gesundheitswesen Helgolands Die Jahre 18861889 - Geologie Mineralogie Und Lagerstttenlehre - Atlas Of Cancer Mortality In Poland 19751979 - Klassiker Der Pdagogik - Preismanagement - Kinderheilkunde Und Pflege Des Gesunden Kindes Schwestern Und Sorgerinnen - Die Elektrizitt Im Aufgabenkreis Der Deutschen Technik - X-ray Astronomy - Soziologie Der Ernhrung - Deutschland Nach Hitler - Emil Rathenau Und Das Werden Der Groywirtschaft - Optical Characterization Of Epitaxial Semiconductor Layers - Moderne Und Gewalt - Bau Und Eigenschaften Der Organischen Naturstoffe - Die Neuropathologischen Syndrome - Robotersysteme 3 - Die Satisfaction-profit Chain In Der Logistikdienstleistungsbranche - Das Kreisdiagramm Der Induktionsmotoren - Kants Friedensschrift Und Der Theorienstreit In Den Internationalen Beziehungen - Nach Pisa - Der Einfache Schleimhautkatarrh Der Oberen Luftwege Und Seine Behandlung - Die Berechnung Verankerter Hngebrcken - 3d-kino - Brgerkonferenz Streitfall Gendiagnostik - Jugendliche Und Drogen - Radiological Exploration Of The Ventricles And Subarachnoid Space - Advances In Sociological Knowledge - Supervision Auf Dem Prfstand - Performance Und Skalierung Von Sap Erp Systemen In Virtualisierten Umgebungen - Sexualisierte Gewalt - Der Pdagoge Salzmann - Neurophysiologische Untersuchungsmethoden In Der Intensivmedizin - Semantik Der Deixis - Decompiling Android - Bilder Der Arbeit - Die Unfall- Und Gesundheitsgefahren In Der Steinkohlenteerdestillation Nebst Einigen Vorschlgen Zu Ihrer Bekmpfung - Bildungsgerechtigkeit Jenseits Von Chancengleichheit - Karst Hydrology - Neuere Erfahrungen Ber Die Behandlung Und Beseitigung Der Gewerblichen Abwsser - Die Gemeinntzige Gmbh - Chemical Sensors - Grundzge Zu Einer Wissenschaftlichen Theorie Des Freihandels - Bedienung Und Schaltung Von Dynamos Und Motoren Sowie Kleine Anlagen Ohne Und Mit Akkumulatoren - Exchange Server 2000 Installieren Konfigurieren Administrieren Optimieren - Die Hochspannungs-gleichstrommaschine - Modified Inferior Turbinoplasty - Der Souvern Auf Der Nebenbhne - Production Planning In Automated Manufacturing - Distributed Autonomous Robotic Systems - Brgerrechte Im Netz - Das Integrationspotential Des Internet Migranten - Hepatocellular Carcinoma And Liver Metastases Diagnosis And Treatment - At1-rezeptorblockade - I Geologie Markscheidewesen - Folgen - Polyimides - Die Aktiengesellschaft Nach Den Vorschriften Des Handelsgesetzbuchs Vom 10 Mai 1897 Dargestellt Und Erlutert Unter Angung Eines Normalstatuts - Handlungswissen Der Sozialen Arbeit - „sthetische Kommunikation Der Moderne - Frontiers In Social Dilemmas Research - Glcksspiel - Chinese Drugs Of Plant Origin - Der Verkehr Mit Arzneimitteln Und Giften Ausserhalb Der Apotheken - Dynamics During Spectroscopic Transitions - Modell „bad Bank Hintergrund - Konzept - Erfahrungen - Die Psychoanalyse - Apothekengesetze - Praxisbuch Mrt Abdomen Und Becken - Schichttypische Benachteiligung Im Allgemeinen Bildungswesen - Die Deutschen Lnder - Collaborative Model For Promoting Competence And Success For Students With Asd - Dynamisches Finanzmanagement In Der Praxis - Timingstrategien In Innovationspartnerschaften Der Deutschen Ernhrungsindustrie - Langsamkeit Entdecken Turbulenzen Meistern - Leadership In Krisen - Die Politische Deutungskultur Im Spiegel Des „historikerstreits - Grundkurs Java-technologien - Wider Die Sozialistische Familiennorm - Macht Markt Meinungen - Von Der Diktatur Zur Demokratie - Handbuch Soziodrama - Funktionelle Dopplersonographie In Der Neurologie - Die Einsamkeit Des Schreibers - Die Spt-renaissance - Lust Auf Leistung - Grundlagen Der Chemotherapie - A Course In Mathematical Physics 1 - Concise Cardiology - Die Mechanischen Beweise Die Bewegung Der Erde - Analytische Und Prparative Labormethoden - Dokumentenakkreditivgeschft - Nuklearmedizin In Der Orthopdie - Soziale Arbeit Und Soziales Kapital - Medical Management Of Hiv And Aids - Erfolgsausweis Deutscher Aktienkonzerne - Malignant Brain Tumours - Unvollstndige Akteure - Elemente Der Neurologie - Die Geschichte Der Sozialen Arbeit In Europa 19001960 - Exploring Curvature - Die Chromatische Alteration Im Liturgischen Gesang Der Abendlndischen Kirche - Der Internationale Rechtsschutz Der Patente Muster Warenzeichen Und Des Wettbewerbes - Cruise Management - Baustoffe Und Baustoffprfung - Die Wirkung Der Kundenloyalitt Im Vertikalen Wettbewerb - Jenseits Der Flucht - Anilinschwarz Und Seine Anwendung In Frberei Und Zeugdruck - Geometric Structure Of High-dimensional Data And Dimensionality Reduction - Thin-layer Chromatography - Mehrfachregelungen Grundlagen Einer Systemtheorie - Aseismischer Anlagenbau - Die Beiden Deutschen Staaten In Der Dritten Welt - Dabeisein Und Dazugehren - Ein Haus Ein Aufruhr - Potassium Argon Dating - Wirtschaftslehre Des Handels - Keine Panik Vor Ingenieurmathematik! - Sexual Reproduction In Higher Plants - Die Seehafenpolitik Der Deutschen Eisenbahnen Und Die Rohstoffversorgung - Die Kalkulation Und Organisation In Frbereien Und Verwandten Betrieben - Computational Systems Neurobiology - Grundkurs Computergrafik Mit Java - Size Exclusion Chromatography - Wirtschaftsmathematik Leicht Gemacht - Mixed Reality - Jugend Und Mode - Jugend Und Wohnen - Weberei - Physics Of Thin Films - Teilhaben An Schule - Rechnen Bankkaufleute - Inszenierte Information - Ultraschalldiagnostik 88 - Erfolgsfaktor Ich - Medien Und Die Soziale Konstruktion Von Zeit - Critical Leg Ischaemia - The Lec Rat - Deutschland 2020 - Fundamentals Of The Average Case Analysis Of Particular Algorithms - Elementarteilchen - Formeln Und Fakten - Einhrung In Die Elektronik - Grundkurs Mathematik Ingenieure - Normal Ultrasound Anatomy Of The Musculoskeletal System - Interaktionsprofile - Nationalstaaten In Der Eu Identitt Und Handlungsmglichkeiten - Matlab Und Simulink In Der Ingenieurpraxis - Richtlinien Zur Medizinischen Indikation Der Schwangerschaftsunterbrechung - Speicheldrsenerkrankungen - Finanzierung Und Investitionen Im Gesundheitsbetrieb - Benzodiazepines Ii - Die Technik Der Individualpsychologie - Diurese Und Diuretica Diuresis And Diuretics - Psychologie Als Gesellschaftswissenschaft - Bezugsgruppenwechsel Und Bildungsaufstieg - Bildung Unter Bedingungen Kultureller Pluralitt - Technologie - Physik Und Chemie Der Grenzflchen - Leistungsgerechte Vergtung Verkaufsteams - Dictionary Of Abbreviations In Medical Sciences - Biological Mechanisms Of Attachment - Das Recht Der Brsen - Grundlagen Und Mathematische Hilfsmittel Der Hochfrequenztechnik - Liebe Zwischen Ehre Und Engagement - Elektrokeramik - Erfolgreich Projekte Leiten - Praktische Bauphysik - Die Russische Hunger- Und Seuchenkatastrophe In Den Jahren 19211922 - Gewalt In Huslichen Beziehungen - Perioperative Management Of Patients With Rheumatic Disease - Medientraining Manager - Die Kathodenstrahlrhre Und Ihre Anwendung In Der Schwachstromtechnik - Die Asynchronen Wechselfeldmotoren - Betriebswirtschaftliche Hrungslehre Grundlagen Strategien Modelle - Insect Hormones And Bioanalogues - Die Stahlindustrie Der Vereinigten Staaten Von Amerika In Ihren Heutigen Produktions- Und Absatz-verhltnissen - Mikrofluidik - Die Wirkung Niedriger Strahlendosen - Das Konzept Der Metropolregion In Theorie Und Praxis - Multilokales Wohnen - Der Ausgleich Des Gebirgsdruckes In Groyen Teufen Beim Berg- Und Tunnelbau - Motivanalyse Zu Anwenderinnovationen In Online-communities - Mehr Leidenschaft Recherche - So Entsteht Ihre Groye Karriere - Der Wrmebergang Und Die Thermodynamische Berechnung Der Leistung Bei Verpuffungsmaschinen Insbesondere Bei Kraftfahrzeug-motoren - Irans Kampf Um Wasser - Spanende Werkzeugmaschinen - New Directions For Operations Research In Manufacturing - Aktuelle Probleme Der Nephrologie - Herausforderungen Der Wirtschaftsinformatik - Verkaufserfolge Steuern Und Optimieren - Wege Zum Vitalen Unternehmen - Das Buerger-syndrom Thrombangiitis Obliterans - Wissensmanagement In It-unternehmensberatungen - Der Semidnnschnitt - Ausschreibungshilfe Rohbau - Free Radicals And The Liver - Chirality - Sonographische Diagnostik In Der Unfallchirurgie - Das Waschen Mit Maschinen In Gewerblichen Wschereibetrieben In Hotels Krankenhusern Und Anderen Ffentlichen Und Privaten Anstalten - The Effects Of Cause-related Marketing On Customers Attitudes And Buying Behavior - Lehrbuch Der Elektrochemie - Die Statik Des Ebenen Tragwerkes - Hilfsbuch Betriebsberechnungen - Einfuhrung In Die Wellenmechanik - Beitrge Zur Psychodynamik Endogener Psychosen - Digitalrechner Grundlagen Und Anwendungen - Adaption Und Lernen Von Und In Organisationen - Reoperations In Cardiac Surgery - Cim Lexikon - Interaktionsformen - Erschpfte Familien - Werte Und Wertewandel In Westlichen Gesellschaften - Kanaldichtungen - Europisierung Der Inneren Sicherheit - Cg International 90 - Mri Atlas Of Central Nervous System Tumors - Grundzge Der Brillenlehre Augenrzte - Differenzengeometrie - Doping Dokumente - Hydrogeologische Untersuchungsmethoden Von Altlasten - Erfolgreiches Markenmanagement - Methoden Der Ganzzahligen Optimierung - Der Verschenkte Konsens - 85 Jahre Universittsklinik Dermatologie Und Venerologie Zrich 19162001 - Unternehmensbewertung In Theorie Und Praxis - New Connectivities In China - The Design Of A Microprocessor - Nachhaltiges Personalmanagement - Organisieren Und Organisationen Verstehen - Epochen Moderner Literatur - Frauen Und Mnner In Der Mobilen Gesellschaft - Leistungsfhigkeit Und Keimdrsenhormone - Tuberculosis Of The Skeleton - Bildung Neu Denken! Das Juristische Konzept - Finanzmathematik - Die Gemeinschdlichkeit Der In Aussicht Gestellten Erhhung Der Kornzlle - Functional Instability Or Paradigm Shift - Elastisches Wuchten - Cad Bauingenieure - Demografischer Wandel In Der Unternehmerischen Praxis - Medizinrecht Psychopathologie Rechtsmedizin - Wirksamkeit Deutscher Berufsbildungszusammenarbeit - Proceedings Of The 17th International Conference On The Physics Of Semiconductors - Die Interferenzen Von Rntgen- Und Elektronenstrahlen - Atherosclerosis Vi - Mit Branding An Die Spitze! - Automobil-meytechnik - Kinematisch-getriebeanalytisches Praktikum - Statistische Datenanalyse - Lehrbuch Der Haut- Und Geschlechtskrankheiten - Entfesselte Wissenschaft - Der Staat Als Zufall Und Als Notwendigkeit - Mining Subsidence Engineering - Evaluation Von Studium Und Lehre - Herrschaft In Der Modernen Gesellschaft - Politische Kommunikationskultur - Anaerobtechnik - Ausschreibungshilfe Haustechnik - Endocrine Disorders In Thalassemia - Die Wow-prsentation - Stabilitt Und Transformation Politischer Systeme - Prognosefhiger Erfolg Nach Iasifrs - Pancreatitis - Unternehmerhandbuch Bau - Nahost Jahrbuch 1989 - Baukosten Senken - Aktienrechtliche Jahresabschluyprfung - Java 7 Recipes - Beitrge Zum Verfassungs- Und Wirtschaftsrecht - Erfolgreich Verkaufen Im Handel - Architektur Zeichnen - Frankreich Und Das Vereinigte Deutschland - Die Leberkrankheiten - Die Regierbare Stadt - Rock Mechanics - Prfung Und Verarbeitung Von Arzneidrogen - Software-ergonomie In Der Gruppenarbeit - Aufschaukelung Und Dmpfung Von Schwingungen - Fluorescence Spectroscopy - Reengineering Zwischen Anspruch Und Wirklichkeit - Aus Dem Bernerland - The Beginnings Of Cancer In The Cell - Postsozialistische Krisen - Assembler- Programmierung Mit Dem Pc - Human-environment Relations - Die Wirtschaftliche Und Soziale Lage Der Technischen Privatangestellten In Der Deutschen Elektroindustrie - Raising Public Awareness Of Mathematics - Das Neue Europarecht - Gender Medienkompetent - Commodity Procurement With Operational And Financial Instruments - Sehen Und Erkennen - Klinikalltag Und Arbeitszufriedenheit - The Juxtaglomerular Apparatus - Thoracic Surgery - The Implementation Of The Eu Services Directive - Holistisches Projektmanagement - Verliebt Verlobt Verheiratet - Rickettsiosen Und Protozoenkrankheiten - Ambulantes Operieren Der Neue Weg In Der Gynkologie - Psychoanalyse Im Kontext - Jahresbericht Ber Die Beobachtungs-ergebnisse Der Von Den Forstlichen Versuchsanstalten Des Knigreich Preussen Des Knigreich Wrttemberg Des Herzogthum Braunschweig Und Der Reichslande Eingerichteten Forstlich-meteorologischen Stationen - Infinitesimalrechnung - Klinik Und Therapie Der Vegetativen Funktionsstrungen - Advances In Turbulence 3 - S+spatialstats - Junge Familien In Der Bundesrepublik - Energy And Environment - Global Interdependence - Morphologische Bildverarbeitung - Proceedings Of The Third Conference On Mechatronics And Robotics - Mergers And Acquisitions Im Mittelstand - Energieversorgung Elektrischer Bahnen - Grundriss Der Suglings≈ Und Kleinkinderkunde - „arbeiterklasse Oder Arbeitnehmer - Print Medium Mit Zukunft - Advances In Econometrics Income Distribution And Scientific Methodology - Anleitung Zur Qualitativen Analyse - Aktuelle Neuropdiatrie 1988 - Exkursionsbuch Zum Bestimmen Der Vgel In Freier Natur - Manual Of Disaster Medicine - Science Education In International Contexts - Cause Related Marketing - Englisch Baufachleute Langlais Dans Le B¢timent - Anleitung Zur Quantitativen Bestimmung Der Organischen Atomgruppen - Kontinuitt Des Wandels - Kampf Um Zugehrigkeit - The Elbow - Transsophageale Echokardiographie Monoplanbiplan - Arƶnei Als Wert - Lexikon Der Pflanzlichen Fette Und –le - Kurzes Lehrbuch Der Kolloidchemie - Sonographie Der Kopf-hals-region - Impulsschaltungen - Laue Atlas - Die Dampfturbinen Mit Einem Anhange Ber Die Aussichten Der Wrmekraftmaschinen Und Ber Die Gasturbine - Macht Und Herrschaft - Leitfaden Der Histologie Des Menschen - Jenseits Und Diesseits Der Betriebswirtschaftslehre - Jugendliche Maghrebinischer Herkunft Zwischen Stadtpolitik Und Lebenswelt - Operations Research Im Bauwesen - Lehrbuch Der Pflanzenphysiologie - Die Physikalischen Grundlagen Der Elektrischen Festigkeitslehre - Trivialliteratur Und Popularkultur - Parteiorganisation Im Wandel - Faszination Wolfsburg 1938-2012 - Der Tierarzt Im Hause - Die Klinik Der Beginnenden Tuberkulose Erwachsener - The Chemical Physics Of Surfaces - Mnnerpolitik - Mehrgryenregelungen - Das Elektrostahlverfahren - Frauen Und Das Institutionelle Europa - Handel Und Umwelt - Advances In Turbulence 2 - Sport Und Krperliche Aktivitt In Der Onkologie - Kommunikation Ber Kommunikation - Grundriy Der Gesamten Praktischen Medizin - Chemische Sensoren - Einhrung In Die Lineare Algebra - Lehrbuch Der Allgemeinen Humangenetik - Ich Hab Mehr Das Gesprch Gesucht - Interessen Ideen Und Institutionen - Ergebnisse Der Lepraforschung Seit 1930 - Die Praxis Der Hydrotherapie Und Verwandter Heilmethoden - Leitfaden Umwelthandbcher Mit Praxisbeispielen - Stromrichterschaltungen - Pdosexualitt - Mediensoziologie - Nonresponse In Bevlkerungsumfragen - Aktiv Und Gesund - Pps-systeme Und Organisatorische Vernderungen - Das Deutsche Gemeinderatsmitglied - Brger Oder Bettler - Die Betriebswirtschaftliche Organisation In Speditionsgroybetrieben - Praxisfeld Hilfe Zur Erziehung - Motivation And Action - Ergebnisse Der Biologie - Labor Zelle - Allgemeine Literaturwissenschaft - Trinkwasser Und Abwasser In Stichwrtern - Die Regelung Der Kraftmaschinen - Aids And Obstetrics And Gynaecology - Saunders Mac Lane Selected Papers - Handbuch Der Jugendforschung - Konfliktforschung - Die Behandlung Innerer Krankheiten Mit Radioaktiven Substanzen - Rheumatic Diseases And The Heart - Erwerbsttigkeit Und Familie In Steuer- Und Sozialversicherungssystemen - Computergraphik Und Bildverarbeitung - Unvergessene Diskurse - Hilfsbuch Den Apparatebau - Ingenieur-mathematik - Der Rastlose Mensch - Mythen In Der Politik Der Ddr - Professionelle Verkaufsprsentation - Cardiomyopathies - Hans J Morgenthau Und Der Weltpolitische Realismus - Demokratie Und Politik In Der Bundesrepublik 19491999 - Ellbogenchirurgie In Der Praxis - Entwicklung Der Geburtshilfe Und Gynkologie Im 19 Jahrhundert - Informationskontexte Massenmedien - Corporate Governance Und Managementberatung - Theorie Und Technik Der Pulsmodulation - Artificial Heart 3 - Flexibilitt In Langfristigen Vertrgen - Weiterbildung Von Frauen In Den Neuen Bundeslndern - Die Ausbildung Des Mediziners - Interventional Radiology In Bone And Joint - Forests Elements Of Silvology - Cooperative Phenomena - Handbuch Kriegstheorien - Source And Sediment - Pr-ausbildung In Deutschland - Die Religion Des Geldes - Niedrigdosisstrahlung Und Gesundheit - Grenzgeschwindigkeiten Und Ihre Paradoxa - Praxiswissen Presse- Und –ffentlichkeitsarbeit - Online-journalismus - Clinical Aspects Of Blood Viscosity And Cell Deformability - Computational Organometallic Chemistry - Konstruktionspraxis Formgedchtnistechnik - Gleithernie Und Refluxkrankheit - Cross Border Experts 2011 - Multiresonator-based Chipless Rfid - Transatlantik - Diagnostik Der Kinderkrankheiten Mit Besonderer Bercksichtigung Des Suglings - Families Schools And Delinquency Prevention - Die Permeabilittspathologie - Urbaner Bodenschutz - Werkstckspanner - Handbuch Des Revolverdrehers - Die Ltrohranalyse - Pathology Of The Pancreas - Rckfall In Die Barbarei - Goethes Und Schopenhauers Stellung In Der Geschichte Der Lehre Von Den Gesichtsempfindungen - Approaches To The Clivus - Elemente Der Chemie-ingenieur-technik - Identitt Und Rolle - Medienethik Und Die "anderen" - Wissenschaftliche Und Alternative Medizin - Cad Werkzeug Des Architekten - Advanced Organic Chemistry - Friedrich List Deutschlands Grosser Volkswirth - Die Regulationsfunktion Des Menschlichen Labyrinthes Und Die Zusammenhnge Mit Verwandten Funktionen - Algebraische Strukturen - Bildungssysteme Und Soziale Ungleichheit - Grundriss Der Botanik - Handbuch Der Feuerungstechnik Und Des Dampfkesselbetriebes - Grundlagen Der Elektronik - Participatory Governance - A Handbook Of Treatment - Die Constantinische Schenkungsurkunde - Deutschland Im Soziokonomischen Systemvergleich - Funkkolleg Altern 1 - Allgemeine Und Spezielle Elektrochirurgie - Output Measurements For Medical Ultrasound - Fremde Als Ordnungshter - Organisationen Regeln - Programmierkurs Turbo-pascal Version 70 - Vertigo - Leitsymptom Schwindel - Die Reizbewegungen Der Pflanzen - Arbeitsbetonter Deutschunterricht Als Mittelpunkt Der Geistesbildung Im 4 Schuljahr - Rationales Handeln Und Soziale Prozesse - Phase Diagrams And Ceramic Processes - Karrierewege Als Thema Der Internen Kommunikation - Quantitative Marketing And Marketing Management - Recent Progress In The Chemical Synthesis Of Antibiotics - Interaktionale Rezeptionsforschung - Performance Based Logistics - Clifford Algebras With Numeric And Symbolic Computations - A New Institutional Economics Perspective On Industry Self-regulation - Das Vervollstndigte Cross-verfahren In Der Rahmenberechnung - Chirurgische Intensivmedizin - Advances In Ct Iii - Food Webs - Hilfsbuch Dampfmaschinen-techniker - Bacterial Adhesion - Laplace- Fourier- Und Z-transformation - Gynkologie Und Geburtshilfe 1994 - Facets Of Modern Biogeochemistry - Atlas Of Color-coded Doppler Sonography - Prvention Familien Mit Psychisch Kranken Eltern - Betriebliches Interessenhandeln - Verkaufen Mit Offenen Ohren - Energietaschenbuch - Die Konstruktionssthle Und Ihre Wrmebehandlung - Mehr Gewinn Durch Systematische Vermgensplanung - Ethnizitt Und Raum Im Aufstiegsprozey - Crystalline Bacterial Cell Surface Layers - European Monetary Integration - Energieeffiziente Elektrische Antriebe - Abschied Von Der Toskana - Die Technik Und Der Krieg - Menschenrechtsbildung - Der Rechtsstaat - Acta Historiae Neerlandicaestudies On The History Of The Netherlands Viii - Mobile Gesellschaft Und Soziale Arbeit - Neuronale Netze In Der Finanzwirtschaft - Lehrbuch Der Ohrenheilkunde - Der Kondensator In Der Starkstromtechnik - Die Krankhaften Psychischen Strungen Der Rckwandlungsjahre Vom Klinischen Standpunkt Aus - Kundennutzen Die Anwendung Im Verkaufsgesprch - Das Waagerecht-bohr- Und Frswerk Und Seine Anwendung - Die Verwaltung Der Ffentlichen Arbeiten In Preuyen 1900 Bis 1910 - Gemeinschaftsverpflegung - Computational Fluid Dynamics - New Advances In Computer Graphics - Vita-massenez Chemische Untersuchungsmethoden Eisenhtten Und Nebenbetriebe - Differentialdiagnose Seltener Lungenerkrankungen Im Rntgenbild - Flow Visualization Vi - Grundlagen Der Erforschenden Statistik - Wie Lernt Die Politik - Handbuch Der Physiologisch- Und Pathologisch-chemischen Analyse „rzte Und Studierende - Datenverarbeitung Ingenieure - Die Unmittelbare Kranken-untersuchung - Grundriy Der Mineralparagenese - Fernsehjournalismus Und Die Wissenschaften - Theories Of Neurosis - Fortschritte Und Probleme In Der Therapie Innerer Krankheiten - Die Relaissteuerungen Der Modernen Starkstromtechnik - Gefychirurgie - Rechnungslegung Steuerung Und Aufsicht Von Banken - Clinical In Vitro Fertilization - Discrete-time Linear Systems - 25 Jahre Kaiser Wilhelm-gesellschaft - Georg Simmel Und Max Weber - Brgerinformation Durch „neue Medien - Die Expansion Der Herrschaft - An Introduction To Teichmller Spaces - Forever Young - Fundamentals Of Cosmic Particle Physics - The Human Yolk Sac And Yolk Sac Tumors - Das Politische System Der Volksrepublik China - Metallkleben - Sustainable Manufacturing - Natural Draught Cooling Towers - Explosive Shocks In Air - Das Pneumencephalogramm - Die Prfung Der Arzneistoffe Nach Dem Deutschen Arzneibuch - Selbst-pr Verkufer - Zur Genealogie Des Politischen Raums - Kompressoren-anlagen - Wenn Hrungskrfte Irren - Projektmanagement Der Sw-entwicklung - Ios 5 Recipes - Aal- Und E-health-geschftsmodelle - Gut Beraten Durch Die Promotion - Neurochirurgische Operationen - Die Vereinten Nationen Im 21 Jahrhundert - Der Geist Der Technik - Mathematische Bildung Und Neue Technologien - Reef Diagenesis - Analytische Und Konstruktive Differentialgeometrie - Macromolecular Complexes In Chemistry And Biology - Corporate Citizenship - Recovery From Brain Damage - Innovation Resources And Economic Growth - Soziale Struktur Und Wissenschaftliche Praxis Im Wandel - Medizinische Und Therapeutische Kommunikation - Determinanten Der Markteintrittsreihenfolge Von Imitativen Internet Start-ups - Algebra Und Zahlentheorie - Stahlbetonbau Nach Ec 2 - Lipide Und Lipoproteide Im Blutplasma - Rituale Der Transformation - Zeitreihenanalyse In Den Wirtschaftswissenschaften - A Supply-side Agenda For Germany - Zugang Zu Internet Und Digitalem Fernsehen - Brand- Und Explosionsschutz Von A-z - Unternehmensfinanzierung Mit Dem Kapital-dienstleistungsgrad - A Short Textbook Of Clinical Imaging - Industrial Aromatic Chemistry - Transformation In Ungarn Und Der Ddr - œbungen Zur Technischen Strmungslehre - The Future Of Vocational Education And Training In A Changing World - Religion Ohne Institution - Magnetic Resonance Imaging And Spectroscopy In Sports Medicine - Fit Nachhaltigkeit - Energie - Industrieroboter - Die Grundlagen Der Raumkhlung - Kalkulierte Kreativitt - Beton Anregungen Zur Verbesserung Des Materials - A Practical Guide To Human Cancer Genetics - High-risk Breast Cancer - Platow Prognose 2009 - Afrika Jahrbuch 1989 - Politische Soziologie - Japan Europa Usa - Anleitung Zur Bearbeitung Meteorologischer Beobachtungen Die Klimatologie - Menschheit Auf Dem Prfstand - Protokolle Der Volkskammer Der Deutschen Demokratischen Republik - Berlin Metropole Zwischen Boom Und Krise - Die Volkspartei - Die Genaue Berechnung Von Trgerrosten - œbungsprogramm Zur Statistischen Methodenlehre - Gebiss- Kiefer- Und Gesichtsorthopdie - Familiendiagnostik - Selenium In Biology And Medicine - Nondestructive Characterization Of Materials - Prvention Von Jugendgewalt - Erlebnisse Eines Alten Parlamentariers Im Revolutionsjahre 1848 - Chemie Und Fabrikation Der Tierischen Leime Und Der Gelatine - Buchhrung Speditionskaufleute - Derivate Im Risikomanagement Von Fuyballunternehmen - Das Englische Verwaltungsrecht Mit Einschluy Des Heeres Der Gerichte Und Der Kirche Geschichtsich Und Systematisch - Alle Wege Hren Zum Menschen - Die Malariatherapie Der Syphilis - Einhrung In Die Hhere Mathematik - Familie In Der Gesellschaft - Wissenschaft In Der Wissensgesellschaft - Stdtebau - Richard Dedekind 18311981 - Einhrung In Die Systemtheorie - Erwachsenenbildung In Politischen Umbrchen - Menschenkenntnis Verkufer - Lehrbuch Der Forsteinrichtung Mit Besonderer Bercksichtigung Der Zuwachsgesetze Der Waldbume - Nf Jahrtausende Radfahrzeuge - Rotation Divergenz Und Gradient - Abschottungs- Und Anwerbungsstrategien - Bauordnung Berlin - Phnomenologie Des Wollens - Biochemistry Of Cell Walls And Membranes In Fungi - Laienkompetenz Im Psychosozialen Bereich - Die Berechnung Von Gleich- Und Wechselstromsystemen - Konstruktion Und Material Im Bau Von Dampfturbinen Und Turbodynamos - Telekommunikation Und Jugendkultur - Die Chemie Des Fluors - Cryptorchidism - Aspekte Der Internationalen –konomieaspects Of International Economics - Hren Im Ffentlichen Bereich Und In Non-profit-organisationen - Der Mensch Im Industriebetrieb - Im Zeichen Des Umbruchs - Schwarze Lcher Im All - Frieden Oder Sicherheit - Hessen Im Wandel - Eindrcke Aus Der Eisenindustrie Der Vereinigten Staaten Von Nordamerika - Ingenieur-mathematik Lehrbuch Der Hheren Mathematik Die Technischen Berufe - Die Apotheken Gesetzgebung Des Deutschen Reiches Und Der Einzelstaaten Auf Der Grundlage Der Allgemeinen Politischen Handels- Und Gewerbegesetzgebung Dargestellt - Sozial- Und Wirtschaftspolitik Unter Rot-grn - Ellenbogenmentalitt Und Fremdenfeindlichkeit Bei Jugendlichen - Production Wine Analysis - Der Ausbau Der Wirtschaftlichen Einteilung Des Wege- Und Schneisennetzes Im Walde - Soziale Investitionen - Inszenierungsgesellschaft - Artificial Liver Support - Aroma Biotechnology - Chancen Die Erwerbsarbeit Im Alter - Praxiswissen Anzeigenverkauf - Betriebswirtschaftliche Fallstudien - Leitfaden Auyenwirtschaft - Unterrichtsplanung Politiksozialkunde - Kreativitt Im Cyberspace - Ingenieurmechanik 2 - Unternehmenshrung Und Kapitalmarkt - Supply Chain Excellence Im Handel - Die Tuberkulose Und Ihre Bekmpfung Durch Die Schule - Grundlagen Der Bodenmechanik - Gleichgewicht Und Reibungslose Bewegung - Nuclear Magnetic Resonance Spectroscopy Of Cement-based Materials - Handbuch Elektrotechnik - Chancen Fouls Und Abseitsfallen - Elektrische Maschinenverstrker - Deutschlands Finanzlage Nach Dem Kriege - Systematische Klassifikation Der Massengesteine - Grundriy Der Verfassung Und Verwaltung In Preuyen Und Dem Deutschen Reiche - Nonconventional Yeasts In Biotechnology - Atlas Der Morphologischen Plazentadiagnostik - Lehrbuch Der Funktionentheorie - Elemente Des Werkzeugmaschinenbaues - Aktuelle Therapie Gastrointestinaler Tumoren - Schillerpromenade 27 12049 Berlin Ein Haus In Europa - The Climate Of China - Atlas Of Electroencephalography In Sleep Medicine - Young Urban Poor - Temperatur Und Leben - Handbuch Der Spinnerei - Deutsche Direktinvestitionen In Der Volksrepublik China - Vertragsrecht Im Einkauf - Bauvertragsrecht - Medienpolitische Strategien Das Interaktive Fernsehen - Change Power - Bilanzanalyse Mit Ms Access - Existenzgrndung It - Arbeitsbuch Zur Produktionspolitik - Perspektive Und Axonometrie - Anleitung Die Polizeilichen Revisionen Der Metzgerte Vom 22 Juli 1925 - Methodologie Der Sozialwissenschaften - Wer Kauft Was Warum Nicht - Die Gonorrhoe Des Weibes - Systemprogrammierung In Unix Linux - Amerikanische Und Deutsche Lhne - Gewsser Als –kosysteme - Seniorenpolitik Aus Der Akteursperspektive - Corporate Identity In Banken - Grundlagen Der Gynkologischen Ausbildung - Funktionale Grammatik Und Sprachbeschreibung - Arteriosklerose Und Fibrininkorporation - Einheitliche Bezeichnung Der Lokomotiven Tender Und Triebwagen - Schlkes Formeln - Strahlen Und Strahlenschutz - Elastisch Kleben - Verantwortung - Zwischen Zsur Und Zensur - Applied Mathematics For Database Professionals - Die Grundgesetze Der Wrmeleitung Und Ihre Anwendung Auf Plattenfrmige Krper - Aufgaben Der Eisenbahn-politik - Pathologie Der Ableitenden Harnwege Und Der Prostata - Schlerinnen Und Schler Am Denkmal Die Ermordeten Juden Europas - Marken In Der Politik - Spd Und Grne - Soziales Kompetenztraining - Superfine Particle Technology - Datenstrukturen Objektorientiert Mit Modula-2 - Sozialgeschichte Der Psychologie - Termersetzungssysteme - Calcium Metabolism Bone And Metabolic Bone Diseases - Madagaskar - Von Makis Und Menschen - Leitfaden Zur Beruflichen Wiedereingliederung Und Berentung Des Koronarkranken - Endovascular Treatment Of Intracranial Aneurysms - Vob-musterbriefe Auftragnehmer - Geriatrie Die Hausrztliche Praxis - Entwicklung Und Bedeutung Der Betriebswirtschaftlichen Theorie - Pet And Petct Study Guide - Synthetische Soziologie - Werkstoffkunde Stahl - Turbulent Shear Flows 9 - Kurzer Leitfaden Der Bergbaukunde - Sandstone Depositional Models For Exploration For Fossil Fuels - Leidenschaft Recherche - Anatomie Der Hrrinde - Internationaler Austausch In Der Sozialen Arbeit - 15 Darstellungstheorie Der Endlichen Gruppen - Bndnis Arbeit - Elementare Logik - Gynkologie Und Geburtshilfe 1988 - Mnemotechnik Der Receptologie - Bau Und Berechnung Der Dampfturbinen - Lehrbuch Der Hygiene - Handlungstheorie Und Politische Kultur - Denken Und Handeln An Finanzmrkten - Farbempfindung Farbbeschreibung Und Farbmessung - Die Kaufmnnische Apothekenhrung Und Die Spezialittenfabrikation - Das Bdm-werk „glaube Und Schnheit - Vernetzung Als Soziales Und Technisches Paradigma - Eigentlich Klar Oder - Der Schutz Der Demokratie In Deutschland Und Frankreich - Dynamics Of Multibody Systems - Illustrated Computer Tomography - Modern Aspects Of Electrochemistry - Wrmediagramme Vergasung Verbrennung Und Ruybildung - Politische Teilkulturen Zwischen Integration Und Polarisierung - Konstanten Der Atomphysik - Leitfaden Zum Berechnen Und Entwerfen Von Lftungs- Und Heizungs-anlagen - Analysis In Dimension 1 - Die Kessel- Und Maschinenbaumaterialien Nach Erfahrungen Aus Der Abnahmepraxis Kurz Dargestellt Werksttten- Und Betriebsingenieure Und Konstrukteure - Die Gewinde Ihre Entwicklung Ihre Messung Und Ihre Toleranzen - Medienwirkungen Das Dynamisch-transaktionale Modell - Gelegenheit Und Entscheidung - Flucht Vor Dem Gewissen - Die Abwrmeverwertung Im Kraftmaschinenbetrieb - Arbeitsmethoden Der Thermodynamik - Die Deflation Und Ihre Praxis In England · Den Vereinigten Staaten · Frankreich Und Der Tschechoslowakei - Mittheilungen Ber Den Niederrheinisch-westflischen Steinkohlen-bergbau - Migration Und Nationaler Wohlfahrtsstaat - Erneuerung Der Politik „von Unten - Bacteria In Agrobiology Plant Probiotics - Handbuch Europa In Nordrhein-westfalen - Netzwerkanstze Im Business-to-business-marketing - Immobilienmakler Im Test - Nahost Jahrbuch 2002 - Umweltforschung Und –ffentlichkeit - Sozialpsychologisches Organisationsverstehen - Soziale Form Und Konomisches Objekt - 100 Jahre Bunsen-gesellschaft 1894 1994 - Grundlagen Der Steuerungstechnik - Von Der Deutschlandpolitik Zur Ddr-politik - Vertrauen In Organisationen - Affective And Schizoaffective Disorders - Die Macht Der Reprsentation - Armut Von Kindern Mit Migrationshintergrund - Clustering-based Support For Software Architecture Restructuring - Praxishandbuch Compliance - Dynamische Systeme Steuerbarkeit Und Chaotisches Verhalten - Practical Issues In Anesthesia And Intensive Care - Die Kontrolle In Gewerblichen Unternehmungen - Abschied Von Der Top-down-kultur - Advances In Clinical Neuropsychology - Elementar-mechanik Maschinen-techniker - X-ray Microscopy And Spectromicroscopy - Besondere Aspekte Der Extrakorporalen Zirkulation - Neuer Staat Mit Alten Parteien - Die Knstlichen Kohlen Elektrische –fen Elektrolyse Und Elektrotechnik - The Foundations Of Economics - Selbstorganisation Verantwortung Gesellschaft - Der Einsatz Der Bundeswehr In Afghanistan - Die Elektrischen Einrichtungen Den Eigenbedarf Groyer Kraftwerke - E-markets - Arbeit In Der Mobilen Kommunikationsgesellschaft - Arbeiter Unternehmer Professioneller - Die Mission Des Mzens - Biochemical Engineering For 2001 - Chemische Elementarprozesse - Digital Value Network - Mathcad In Der Tragwerksplanung - Handbuch Der Kinderheilkunde - Paloanthropologie - Ungleichheit - Optical Signal Processing - Der Praktische Fall - Parteiendemokratie In Deutschland - Handbuch Der Evaluationsstandards - Geologie Der Landschaft Um Wien - Bibliographie Zur Deutschen Soziologie - Endourology - Frequenzadaptive Herzschrittmacher - Kinder- Und Jugendhilfe In Der Schweiz - Die Organischen Katalysatoren Und Ihre Beziehungen Zu Den Fermenten - Gehirn Und Auge - Zerstrungsfreie Prfverfahren - Geschichte Der Herzrhythmusstrungen - Unix Software-entwickler - Mobilitt Im Kindes- Und Jugendalter - Deutschland In Europa - Praxishandbuch Rockmusik In Der Jugendarbeit - Handbuch Rechtsradikalismus - Amtstrger In Der Parteiendemokratie - Nahost Jahrbuch 2001 - Studenten In Den Neunzigern Die Neokonservativen - Politikverdrossenheit - Praxis Der Mikrophotographie - Das Devisentermingeschft In Seinen Beziehungen Zur Whrung Und Wirtschaft - Cell And Tissue Culture Models In Dermatological Research - Instruktion Durch Text Und Diskurs - Erfolgsfaktor Rechnungswesen - Cure Of Thermosetting Resins - Datenreisende - Psychoanalytisches Wissen - Geschichte Der Segelschiffe - Bildungspolitik In Deutschland 19451990 - Antiepileptic Drug Interactions - Einfach Mehr Umsatz - Familie - Der Krebs Der Gebrmutter - Derivative Spectrophotometry And Electron Spin Resonance Esr Spectroscopy For Ecological And Biological Questions - Psychology Of Media In Europe - Entscheidungen In Der Individualisierten Gesellschaft - Die Akuten Erkrankungen Der Gaumenmandeln Und Ihrer Unmittelbaren Umgebung - User Experience Innovation - Statistische Datenanalyse Mit Spsspc+ - Die Theorie Der Bodensenkungen In Kohlengebieten Mit Besonderer Bercksichtigung Der Eisenbahnsenkungen Des Ostrau-karwiner Steinkohlenrevieres - Ankunft Im Erwachsenenleben - Die Transintentionalitt Des Sozialen - Red Cell Shape - Powered Flight - Grundfragen Der Theorie Politischer Institutionen - Sportmedizin Kursbestimmung - Die Leistungssteigerung Von Groydampfkesseln - Vernetztes Verkaufen - Taking Action In Science Classrooms Through Collaborative Action Research - Inflammatory Breast Cancer An Update - Euro-bankmarketing - Idiopathic Hydronephrosis - Geometrische Grundlagen Der Architekturdarstellung - Unternehmerischer Wandel - Arzneimittel-atlas 2011 - Maple V Language Reference Manual - Der Regelvorgang Bei Kraftmaschinen Auf Grund Von Versuchen An Exzenterreglern - Der Absatz In Der Chemischen Industrie - Looking To The Future - Die œberpflanzung Der Mnnlichen Keimdrse - Baukalkulation Und Projektcontrolling - Unternehmer Ins Netz! - Der Einstieg Ins –ko-audit Mittelstndische Betriebe - Wirtschafts- Und Sozialkunde Versicherungsfachangestellte - Erzhlen Im Kontext Neuer Lernkulturen - Was Tun - Meilensteine Der Frauen- Und Geschlechterforschung - Perinatal Retinal Haemorrhages - Analyse Der Fette Und Wachse - Welding Metallurgy Of Stainless Steels - Nachhaltiges Lernen In Der Politischen Bildung - Jugend Arbeit Und Interessenvertretung In Europa - Service-exzellenz - Kolloidchemie - Der Mensch In Der Psychiatrie - Handbuch Der Landmaschinentechnik - Surface And Colloid Science - Umweltorientierte Materialwirtschaft - Best Practice In Einkauf Und Logistik - Unternehmenscontrolling - Der Baugrund - Unberechenbare Umwelt - Das Holz Der Deutschen Nadelwaldbume - Zirkulre Positionen - Menschen Auf Der Flucht - Kooperation Im Niemandsland - Wrterbuch Zur Mikropolitik - Grundzge Der Zerspanungslehre Theorie Und Praxis Der Zerspanung Bau Und Betrieb Von Werkzeugmaschinen - Soziale Unruhen Und Politikberatung - Parallelitt Und Transputer - Das Wissen Des Bankkaufmanns - Stahlbetonbau Nach Din 1045-1 - Growth Factors Differentiation Factors And Cytokines - Gleitlager - Blood Supply Of Bone - Hebammen-lehrbuch - Konstruktion Und Geltung - Lexikon It-berufe - Illokutionre Krfte - Novell Netware - Topics In Applied Quantumelectrodynamics - Europisches Management - Aus Der Praxis Des Taylor-systems - Kollektive Identitt In Krisen - Psychosynergetik - Adsorption Of Organic Compounds On Electrodes - Advances In Human Genetics 15 - Die Induktive Wrmebehandlung - Der Praktische Einsatz Von Datenverarbeitungssystemen - Best Services - Psychological Treatment Of Mental Illness - Cocas Fluch - Praktischer Korrosionsschutz - Die Goldwhrung - Physik Im Experiment - O Tempora O Mores - Methods In Protein Sequence Analysis - Neue Bildverarbeitungstechniken In Der Sonographie - Fortschritte Der Botanik - Leitfaden Den Waldbau - Quark Matter - Bildung In Frankreich - Die Zweite Groye Koalition - Visual Basic Net Mit Methode - Gewaltspiralen - Neurolinguistik - Repetitorium Funktionentheorie - Koalitionen In West- Und Osteuropa - Metallfachkunde 3 - Sinnstiftung Als Beruf - Chemische Laboratoriumstechnik - Wrter Dinge - Die Einzelhaus-wasserversorgung - Blade Runner Matrix Und Avatare - Objektives Verstehen - Politische Steuerung - Grundriy Der Physik Naturwissenschaftler Mediziner Und Pharmazeuten - Junge Flchtlinge In Multikultureller Gesellschaft - Texte Und Diskurse - Medienjournalismus - Die Elektrolyte - Viral Marketing - Erfahrene Demokratie Wie Politik Praktisch Gelernt Werden Kann - Technikkritik In Der Moderne - Der Einkauf Als Margenmotor - Beschftigungschancen Und Betriebszugehrigkeit - Beginning Sql Server 2012 Administration - Berufs- Und Karriereplaner Medien Und Kommunikation 20032004 - Begabtenfrderung Im Gymnasium - Individualisierung Und Soziologische Theorie - Risk Assessment For Deliberate Releases - Fuzzy Computational Ontologies In Contexts - Anteil Der Konstruktion Und Des Materials An Dem Wirtschaftlichen Ausbau Niederer Wasserkraft-geflle Mit Besonderer Bercksichtigung Der Verhltnisse An Der Ruhr - Einhrung In Die Theoretische Physik - Die Eisenkonstruktionen - Charakter Und Nervositt - Bernhard Heines Versuche Ber Knochenregeneration - Nichttraumatische Querschnittlhmungen - Migration Familie Und Soziale Lage - The Embryo - Introduction To Polymer Physics - Praxis_ci - Erfolgreich Akquirieren - Objektorientierte Programmierung In Java - Erfolgreiches Change Management In Der Post Merger Integration - Strmung Durch Rohre Und Ventile - Die Restrukturierung Des Arbeitsmarktes - Politikwissenschaft - Constitutive Laws And Microstructure - Dem Andenken An Reinhard Dohrn - Lehrbuch Der Topographischen Anatomie - Lebensarbeit In Der Industrie Und Aufgaben Einer Europischen Arbeitsfront - Jugendarbeit Als Beruf - Herzchirurgie Beim Sugling Und Kleinkind - Mehrfeldrige Zweistegige Plattenbalkenbrcken - Einhrung In Die Fuzzy-logik - Islamophober Populismus - Riemanns Geometrische Ideen Ihre Auswirkung Und Ihre Verknpfung Mit Der Gruppentheorie - –sterreich Zur Jahrhundertwende - Die Strukturierung Konomischer Entscheidungsmodelle - Quality Assurance In An International Higher Education Area - Personalinformationssystem - Zeiss Microscopes For Microsurgery - Holding-strategien - Mehrgittermethoden - Differential Geodesy - Karrierefrauen Und Karrieremnner - Scheitern - „liebe Allein Gengt Nicht - Fremdstoffe In Lebensmitteln - Rechnungswesen Brokaufleute - Frankreich-jahrbuch 1988 - Vergabepraxis Auftragnehmer - Pro Oracle Spatial For Oracle Database 11g - Ideologie Nach Ihrem ‚ende‘ - Betablocker Im Neuen Jahrtausend - Die Hebezeuge Theorie Und Kritik Ausgehrter Konstruktionen Mit Besonderer Bercksichtigung Der Elektrischen Anlagen Ein Handbuch Ingenieure Techniker Und Studierende - Hochqualifiziert Und Arbeitslos - Grundzge Der Unternehmensbesteuerung - Stoffwechsel Und Energiewechsel - Urologische Beckenchirurgie - Dynamik Der Leistungsregelung Von Kolbenkompressoren Und -pumpen Einschl Selbstregelung Und Parallelbetrieb - Frankreichs Privat- Und Handelsrecht - Konfigurationen Lebensweltlicher Strukturphnomene - Klinisches Jahrbuch - Geldanlage Und Steuer 2013 - Intellectual Capital Und Kommunikation - Lehrbuch Der Verwaltung - Surgery Of The Deep Femoral Artery - Pathology Of The Larynx - Experiment Bei Gegenwind - Perception Interaction And Language - Fernsehnachrichten - Optimierung Technischer Produkte Und Prozesse - Sprachtheorie - New Frontiers In Cytology - Handbuch Handel - Form Und Endziel Einer Allgemeinen Versorgung Mit Elektrizitt - Chemical Mutagenesis In Mammals And Man - Laser In Der Fertigung - Der Neue Rechtspopulismus - Messen Steuern Und Regeln In Der Chemischen Technik - Wozu Braucht Man Demokratie - Einmal Verbrecher Immer Verbrecher - Indizes In Der Vergleichenden Politikwissenschaft - Lumbar Spinal Stenosis - Die Unipolare Gleichstrommaschine - Nuclear Medicine Imaging An Encyclopedic Dictionary - Prventive Sucht- Und Drogenpolitik - Neurocritical Care - Aus Forstlicher Theorie Und Praxis - Die Inszenierung Des Neubeginns - Astrophotography - Publizieren Whrend Der Promotion - Konfliktfeld Natur - Drogisten-lexikon Ein Lehr- Und Nachschlagebuch Drogisten Und Verwandte Berufe Chemotechniker Laboranten Groyhandel Und Industrie - Neonatal Tumours - Germanistik Als Wissenschaft - At1-rezeptorantagonisten - Arthroscopy Of The Knee Joint - Immuntherapie In Der Uroonkologie - Eh-ph Diagrams For Geochemistry - Biochemische Genetik - Technikfolgen Abschtzen Lehren - Afrika Jahrbuch 1990 - Arbeitsrecht 1 - Holzbau - Sprung In Die Selbstndigkeit - Personal Im Sozialmanagement - Thallium Myocardial Perfusion Tomography In Clinical Cardiology - Biomonitoring Of Trace Aquatic Contaminants - Risiken Im Bauvertrag - Sensory Hair Cells - Die Angewandte Zoologie - Von Com Zu Profit - Praxis Der Brustoperationen - Management Jenseits Der Postmoderne - Identifikation Loyalitt Und Kooperation - Jahrbuch Medien-pdagogik 4 - Electrical Processes In Atmospheres - Der Hirnstamm Der Maus - Landespolitik Im Europischen Haus - Finite Element Methods For Nonlinear Problems - Nucleic Acids In Immunology - Die Wohlfahrtspflege - Advances In General And Cellular Pharmacology - Raus Aus Der Demotivationsfalle - Die Brgerbewegungen In Der Ddr Und In Den Ostdeutschen Bundeslndern - Das Letzte Jahr Der Sowjetunion - Die Moderne Und Ihre Vornamen - Grundkurs Politikwissenschaft Einhrung Ins Wissenschaftliche Arbeiten - Structural Safety Evaluation Based On System Identification Approaches - Liquid Hydrogen - Die Reklame Des Maschinenbaues - Evolutionary Biology - Contributions To A Computer-based Theory Of Strategies - Sozialwissenschaftliche Datenanalyse Mit R - Handbuch Bankorganisation - Ein Nachhaltig Anderes Parteiensystem - Essential Aspects Of Atopic Dermatitis - Economic Theory Of Fuzzy Equilibria - Die Enquete-kommissionen Des Deutschen Bundestages - Elektrotechnik Im Maschinenbau - Der Verkehrswasserbau - Aufbruch Der Tchter Irans - Stabilitt Und Wandel Von Parteien Und Parteiensystemen - Digitale Lernwelten - Rntgenanatomie Des Gefysystems - Existential-phenomenological Perspectives In Psychology - Sensitivity Analysis In Linear Systems - Soziale Kontrolle - Gelegenheit Macht Diebe Doch Frauen Klauen Auch - Sorgende Arrangements - Mr Imaging Of The Skull And Brain - Strategisches Fundraising - Monoclonal Antibodies - The Hydrogen Atom - Sucht Und Armut - Organisationale Zusammenschlsse Im Nonprofit-bereich - Physik Mediziner - Die Forsteinrichtung - Qualitt Im Kinderfernsehen - Anschauliche Quantentheorie - Korruption Risikofaktor Mensch - Hereditary Colorectal Cancer - –konomie Und Glck - Reliability Evaluation Of Engineering Systems - Cosmic Plasma Physics - Technik Im Wertekonflikt - Wahlen Und Whler - Die Verunreinigung Der Gewsser Deren Schdliche Folgen Sowie Die Reinigung Von Trink- Und Schmutzwasser - Die Institution Schule Und Die Lebenswelt Der Schler - Elemente Der Elektronik - Repetitorium Und Prfungstrainer - Orthopdie Des Sitzens - Plant Viruses - Parteien Und Fraktionen - Die Vertragsmssige Doppelwhrung - Idiopathic Dilated Cardiomyopathy - Die Neue Kommunikationswissenschaft - Analysis Mit Maple - Koalitionen Und Koalitionsvereinbarungen - Altern In Rumlicher Umwelt - Adhesives Technology Compendium 2009 - Environmental Hygiene Iii - Surgical Oncology - Transductions And Context-free Languages - Pflege Im Wandel Gestalten Eine Hrungsaufgabe - Recent Developments In Particle And Field Theory - The Foundations Of Acoustics - Betriebswirtschaft Architekten Und Bauingenieure - Mobilitten In Europa - Elementare Differentialgeometrie Mit Maple - Konstruktionslehre Des Allgemeinen Maschinenbaues - Molecular Cytogenetics - Der Gegenstand Der Psychologie - Formulas Ingredients And Production Of Cosmetics - Wind Turbine Noise - Cad Mit Acad-bau - Psycho-logic - Grundlagen Der Pathologischen Anatomie Studierende Und „rzte - Parametric Optimization Singularities Pathfollowing And Jumps - Chemie Biologen - Baader-meinhofs Kinder - Grenzenlose Konstruktivitt - Kostenrechnung Sozialberufe - Einhrung In Die Psychotherapie Medizinstudierende Und „rzte - Molekl-origami - Lehrbuch Der Organischen Chemie - Die Integration Von Theorie Und Methode In Der Netzwerkforschung - Cardiology For The Primary Care Physician - Frankreich-jahrbuch 2001 - Management Im Gesundheitswesen - Transnationale Vergesellschaftungen - Handbuch Methoden Der Empirischen Sozialforschung - Aktuelle Neuropdiatrie 1989 - Bildung Und Wissenschaft Seit Der Wende - Arzt Aus Leidenschaft - Ditetik Bei Chirurgischen Erkrankungen - Grundkurs Soziologie - Berechnung Der Maschinenelemente - Lernplattformen In Schulen - Crossmedia-strategien - Pierre Bourdieu Neue Perspektiven Die Soziologie Der Wirtschaft - Intellektuelle Und Sozialdemokratie - Die Programmatische Entwicklung Der Pds - Modernisierung Personenorientierter Dienstleistungen - Gewerbepolizeiliche Vorschriften Die Errichtung Und Den Betrieb Gewerblicher Anlagen - Methoden-lexikon Die Sozialwissenschaften - Pro Windows Phone App Development - Bilanz Der Bundestagswahl 2002 - Die Jahr-2000-krise - Programmierung Wirtschaftsinformatiker - Der Durchfluy Des Wassers Durch Rhren Und Grben Insbesondere Durch Werkgrben Groyer Abmessungen - Experiential Education And Adolescents Personal And Spiritual Development - Centrum - Carbon Capture - Technologietechnik - Expertensysteme 87 Konzepte Und Werkzeuge - Wirtschaftsjournalismus - Die Darstellung Der Bauzeichnung - Mittelstand Hat Zukunft - Rettung Eines Flusses - Einhrung In Die –lhydraulik - Alltag Im Kz - Wohlfahrtsstaat Einwanderung Und Ethnische Minderheiten - Jugend Und Arbeitswelt - Cardiac Glycoside Receptors And Positive Inotropy - Scham Ein Menschliches Gehl - Smiths Urologie - Dampfkesselfeuerungen Braunkohle - Die Welt Der Vektoren - Bone Densitometry And Osteoporosis - Rechnerverbindungsstrukturen - Grundriy Einer Meteorobiologie Des Menschen - Gentrification - Konfliktbearbeitung Durch Internationale Organisationen - Arbeitsmarkt Und Wettbewerb - Trends Of Economic Development In East Asia - Risikomanagement Und Kontrag - Wem Dient Der Auswrtige Dienst - Photonic Packaging Sourcebook - The Permian Of Northern Pangea - Leitfaden Zur Pflege Der Wchnerinnen Und Neugeborenen - Der Feinere Bau Der Blutcapillaren - –ko-audits Nach Der Verordnung Der Eu - Materialwirtschaft Und Einkauf - Zur Rationalitt Von Volksabstimmungen - Die Schwimmbagger - Erfinden Und Konstruieren - Erzhlungen Im –ffentlichen - Die Vitale Bank - Lumbar Spine Syndromes - Klingelnberg Technisches Hilfsbuch - Kriegsdiskurse - Anweisung Die Planung Aushrung Und Unterhaltung Von Drnanlagen - Wandel Durch Demokratie - Heldenbilder Im Fernsehen - Die Gleichstrom-dynamomaschine - Grundlegende Statistik Mit R - Brgerliches Recht Betriebswirte - Der Bauratgeber - Gabler Volkswirtschafts Lexikon - Nuclear Electronics - Die Neue Rechte In Deutschland - Advances In Flow Research - Wertschpfungsmanagement Im Einkauf - Unternehmungskrisen - Kompetenz Zur Hrung - Nationale Identitt Im Wandel - Relativistic Quantum Mechanics - Messen Steuern Und Regeln Mit Iconnect - Die Therapie Der Syphilis - Die Krankheiten Des Kaninchens - Demokratie Und Auyenpolitik In Lateinamerika - Der Feldversuch In Der Praxis - Integral Transforms In Geophysics - Jugendliche In Japan Und Deutschland - Wem Gehrt Der Ffentliche Raum - Zur Soziologie Des Essens - Lehrbuch Der Physiologie Studierende Der Zahnheilkunde - Kausalgesetz Und Willensfreiheit - Tatort Schule Gewalt An Schulen 19941999 - Glaucoma Update Iv - Leitbilder Von Gestern - Central Nervous System Monitoring In Anesthesia And Intensive Care - Handbuch Wissenschaftskommunikation - Gps For Geodesy - Testen Von Informationssystemen - Der Verborgene Hunger - Telepublishing - Glaukom - Die Filterung Der Atemluft Und Deren Bedeutung Staubkrankheiten - Der Aufbau Des Mrtels Und Des Betons - Visual Geometry And Topology - A Manual Of Morphometry In Diagnostic Pathology - Aufgabensammlung Mathematik Band 2 Analysis Mehrerer Reeller Variablen Vektoranalysis Gewhnliche Differentialgleichungen Integraltransformationen - Bekmpfung Hoher Grubentemperaturen - Lehrbuch Der Militrhygiene - Grundlagenwissen Medien Journalisten - Die Bedeutendsten Mrtelbildner In Deutschland - Arbeitswelten Von Morgen - Grundriss Der Physik Nach Dem Neuesten Stande Der Wissenschaft - Die Frau - Handbuch Zur Visuellen Diagnose Von Ernhrungsstrungen Bei Kulturpflanzen - Die Ganz Alltgliche Gewalt - Praxis Ohne Theorie - Die Kunst Der Unterredung - Handbuch Der Zahnheilkunde - Verdichteter Wohnungsbau - Der Eisenbahngtertarif In Der Volkswirtschaft - –ffentliches Baurecht Praxisnah - Cimmit 2000 Jahrbuch Immobilien - Qualifizieren Eine Global Vernetzte –konomie - The Vendian System - Festschrift The Institute Of Nuclear Medicine - Die Methode Der Tauschwerthe - Kinder Zu Welchem Preis - Die Logik Der Marke - Handbuch Der Seifenfabrikation - Auftrags- Und Projektmanagement - Der Bundestag - Form Und Funktion Sozialer Netzwerke In Wirtschaft Und Gesellschaft - Psychologie Des Kinderhumors - Computerized Cardiopulmonary Exercise Testing - An Den Grenzen Der Mehrheitsdemokratie - Klinische Vektor-elektrokardiographie - Evolution By Gene Duplication - Elektronen Im Kristall - Handbuch Des Geltenden –ffentlichen Und Brgerlichen Rechts - Mediamatik Die Konvergenz Von Telekommunikation Computer Und Rundfunk - Wissenschaftsindikatoren - Managerial And Organisational Integration - Phase Separation In Cuprate Superconductors - Carbohydrate Metabolism In Pregnancy And The Newborn · Iv - Reiseziel Frankreich - Wahrscheinlichkeitstheorie Und Statistik - Offene Systeme - Moderne Lern-zeiten - Spezielle Magenchirurgie - Handwrterbuch Internationale Politik - Die Eisenbahn Im Wirtschaftsleben - Sozialstrukturen In Lateinamerika - Ethische Investments - Biologically Active Molecules - Heilpdagogik - The Implantable Cardioverterdefibrillator - The Global Race For Foreign Direct Investment - Einwandererverbnde In Der Migrations- Und Integrationspolitik 1998-2006 - Analyse Der Azofarbstoffe - Insomnia - Die Arzneikombinationen - Mathematik Informatiker - Grundlagen Des Marketing - An Atlas Of Axial Transverse Tomography And Its Clinical Application - Einhrung In Die Entwicklungsphysiologie Des Kindes - Digitale Rechenanlagen - Rutschungen Und Ihre Sanierung - Finanzvertrge Und Finanzintermediation - Schwarzbuch Soziale Arbeit - Kapitalmaynahmen - Tierische Sozialarbeit - Helicobacter Pylori 1990 - Deutschlands Volksvermgen Im Kriege - Moderne Stahlgieyerei Unterricht Und Praxis - Technische Elektronik - Kulturelle Befangenheit Und Anpassung - Dutch Elm Disease Research - Jahrbuch - Geschichte Studieren - Verfassungsgebung Und Systemwechsel - Handeln Und Handeln Lassen - Arbeitsmarktpolitik - Bildungslandschaften - Syntax Des Gesprochenen Deutsch - Depressionskonzepte Heute Psychopathologie Oder Pathopsychologie - Advanced Methods Of Physiological System Modeling - Die Berechnung Statisch Unbestimmter Tragwerke Nach Der Methode Des Viermomentensatzes - Berechenbarkeit Und Unlsbarkeit - Projektierung Von Automatisierungsanlagen - Handwrterbuch Des Konomischen Systems Der Bundesrepublik Deutschland - Lexikon Der Elektronik - Issues In Software Engineering Education - Soziologische Theorie Der Gegenwartsgesellschaft - Polarographic Oxygen Sensors - Advances In Superconductivity V - Geschlecht Ethnizitt Klasse - Lndliche Armut Im Umbruch - Erluterungen Zu Den Vorschriften Elektrische Bahnen Bahnvorschriften - Feindbild Minderheit - Recent Developments In Mathematical Physics - Adsorption And The Gibbs Surface Excess - Dekonstruktion Von Geschlechtsidentitt Transversale Differenzen - Historische Studien Und Skizzen Zu Natur- Und Heilwissenschaft - Rumlicher Strukturwandel Im Zeitalter Des Internets - Einsame Spitze - Anleitung Zu Medizinisch-chemischen Untersuchungen Apotheker - Grungschemisches Praktikum - Brgerliches Recht 3 - Planungslexikon - Die Stromversorgung Von Fernmelde-anlagen - Krisenmanagement In Der Gmbh - Die Hirnttigkeit Des Suglings - Die Idee Der Universitt - Revisited - Hydrotherapie Im Hause Des Kranken - Grenzplankostenrechnung - Nonlinear Evolution Of Spatial Economic Systems - Zwischen Rausch Und Realitt - Ultraschall-diagnostik 89 - Differenzierungsfolgen - Automatische Automobilgetriebe - Inhaltsanalyse - Marktwirtschaft In China - Thermoreception And Temperature Regulation - The Nuclear Environmentalist - Gesundheit Und Soziale Lage Von Jungen Menschen In Europa - Grenzgnger - Kulturen Des Kompromisses - Cultural Economics - Burn Care And Treatment - Grundriss Der Wundversorgung Und Wundbehandlung - Neue Amerikanische Verkaufs- Und Lagerverfahren - Rezeptionsforschung - Wege Zum Raum - Die Beobachtung Von Kommunikation - Jugendtrends In Ostdeutschland Bildung Freizeit Politik Risiken - Pro Web Project Management - Unabhngige –ffentlichkeit Und Soziale Bewegungen - Einhrung In Die Programmiersprache Fortran 77 - The Mathematical World Of Walter Noll - Kunstseide Und Zellwolle Nach Dem Viskose-verfahren - Biographien In Deutschland - Die Kondensation Bei Dampfkraftmaschinen - Optimization For Industrial Problems - Introduction To The Theory Of Benzenoid Hydrocarbons - Hhere Mathematik 1 - Familienunternehmen Auslaufmodell Oder Erfolgstyp - Die Entropietafel Luft Und Ihre Verwendung Zur Berechnung Der Kolben- Und Turbo-kompressoren - Mehrfachregelungen - Alfred Andersch - The Phenomenological Theory Of Linear Viscoelastic Behavior - Dieselmotoren In Der Elektrizittswirtschaft Insbesondere Spitzendeckung - –ffentlichkeit Und Gegenffentlichkeit Im Internet - Profikurs Php-nuke - Orthopdisch-chirurgische Operationslehre - Handbuch Der Astrophysik - Mri Of The Head And Neck - Identification Of Materials - Bedeutung Und Wesen Des Patentanspruchs - Geologie Und Radioaktivitt - Handbuch Tauchunflle - Metallfachkunde 5 - Einwanderungsrecht National Und International - Rational Choice Und Theoriegeleitete Evaluationsforschung - Messung Mechanischer Schwingungen Dynamik Der Schwingungsmeygerte - Capillary Electrophoresis - Zukunft Von Stadt Und Region - Cyberbeben - Die Behandlung Der Haut- Und Geschlechtskrankheiten In Der Sprechstunde - Magnetic Resonance - Sip Die Technik - Kreiselrder Als Pumpen Und Turbinen - Die Arbeitenden Klassen Englands - Leitfaden Der Gynkologie - Framework Iii - Automobilrecycling - Funktionen Einer Vernderlichen - Leitfaden Der Mechanik Maschinenbauer - Umwelteinstellungen Und Umweltverhalten In Deutschland - Eisenbahngterverkehr - Das Walzen Von Hohlkrpern Und Das Kalibrieren Von Werkzeugen Zur Herstellung Nahtloser Rohre - Die Banken Auf Dem Weg Ins 21 Jahrhundert - Clinical Measurement In Coloproctology - Theorien Der Kosmologie - Bericht Ber Die Dritte Tagung Ber Psychopathensorge - Information Und Gestaltung - Handbuch Stress Und Kultur - From Ca To Cas Online - Regieren In Der Bundesrepublik Iii - Practical Html5 Projects - Optical Information Processing - Auf Dem Wege Zu Einer Anthropologischen Psychiatrie - Normative Aspekte Der Public Relations - Datenreport Erziehungswissenschaft - Interferone - Die Mediatisierung Kommunikativen Handelns - Demokratie In Europa Und Europische Demokratien - Shock Sepsis And Organ Failure Nitric Oxide - Die Physikalischen Und Chemischen Grundlagen Der Glasfabrikation - The Berlin Creative Industries - Dna Replication The Regulatory Mechanisms - Anatomie Des Menschen Ein Lehrbuch Studierende Und „rƶte - Grenzgebiete Zwischen Psychiatrie Und Neurologie - Rationelle Diagnostik Und Therapie Bei Koronarer Herzerkrankung - Masterkurs It-management - Illustrated Encyclopedia Of Dermatology - Acid Deposition Environmental Economic And Policy Issues - Fraktale Geometrie Eine Einhrung - Peter Weiss Jahrbuch 7 - Projekt- Und Investitionscontrolling Mit Sap R3 - Arthroscopy Of The Shoulder - Beispiele Zur Bemessung Von Betontragwerken Nach Ec 2 - Aktienkursprognose - Bericht Ber Die Vierte Tagung Ber Psychopathensorge Dsseldorf - The Politics Of Cultural Knowledge - Anleitung Zur Erkennung Prfung Und Wertbestimmung Der Gebruchlichsten Chemikalien Den Technischen Analytischen Und Pharmaceutischen Gebrauch - Krpermass-studien An Kindern - Biotransformation Der Arzneimittel - Korrupte Demokratie - Organisationsentwicklung Und Organisationales Lernen Von Schulen - Stiftungsvermgen 2010 - Symmetries In Physics - Sql Mit Oracle - Dermatology In Five Continents - Schulabbrecher In Unserem Bildungssystem - Biological Rhythms - Das Prinzip Unschrfe - Die Wissenschaftlichen Grundlagen Der Elektrotechnik - Kommentar Zum Deutschen Arzneibuch 6 Ausgabe 1926 - Power Transducers For Sonics And Ultrasonics - Professionelle Hrung In Welt 2 - Die Vorkalkulation Im Maschinen- Und Elektromotorenbau Nach Neuzeitlich-wissenschaftlichen Grundlagen - Hauptfragen Der Reichsbahnpolitik - Direktmarketing Mit Kundendaten Aus Bonusprogrammen - Shock Waves @ Marseille I - Hinzunehmende Unregelmyigkeiten Bei Gebuden - Politikwissenschaftliche Methoden - Business-impact-management Von Informationstechnologie Im Unternehmen - Leitfaden Der Deutschen Sozialversicherung - Beobachtung Verstehen Verstehen Beobachten - Guicciardinis Kritik An Machiavelli - Die Differentialgleichungen Des Ingenieurs - Bees As Superorganisms - Auslandsmarketing - Die Krisis Des Deutschen „rztestandes - Growth Hormone And Somatomedins During Lifespan - Macht Und Recht - Neuroactivation And Neuroimaging With Spet - Simulation Neuronaler Netze - Numerische Algorithmen In Softwaresystemen - Applied Ontology Engineering In Cloud Services Networks And Management Systems - Steuerung Unter Der Bedingung Struktureller Koppelung - Was Ist Subsidiaritt - Die Selbstbeobachtungsfalle - Management Reporting - Chemical Water And Wastewater Treatment V - Stckkostenrechnung - Externe Berater Erfolgreich Einsetzen - Taschenbuch Der Wasserwirtschaft - Urban Ecology - Soziologische Beratungsforschung - Die Entzndlichen Erkrankungen Der Weiblichen Geschlechtsorgane - Die Kunst Der Innovation - Verminderung Des Verkehrslrms - First Steps In Mathematica - Biochemisches Handlexikon - Metallurgie Der Ferrolegierungen - Green Solvents Ii - Die Europische Union - Traumberuf Medien - Ist Die Erlebnisgesellschaft In Chemnitz Angekommen - Gabler Kompakt Lexikon Umwelt- Undwirtschaftspolitik - Glcksvorstellungen - Brgerschaft –ffentlichkeit Und Demokratie In Europa - Die Herzogthmer - Wahlkampf Im Web - Handbook Of Children With Special Health Care Needs - Die Wirtschaftliche Lage Von Kanada - Die Halboffenen Anstalten Kleinkinder - Lokale Selbstverwaltung - Machtkonzentration In Der Multimediagesellschaft - Osteoporosis - Theory Of Mind - Die Westeuropischen Gesellschaften Im Vergleich - Handbuch Der Kleinkindforschung - Bismarcks Erbe In Der Reichsverfassung - Models And Measurement Of Welfare And Inequality - Maritime Simulation - Der Lange Weg Zur Erfolgsmannschaft - Kombinationsgerbungen Der Lohe- Weiy- Und Smischgerberei - „rztliche Gesprchsausbildung - Investitionstheorie Und Investitionspolitik Privater Und Ffentlicher Unternehmen - Zement - E-coaching Und Online-beratung - Pedophilia - Chemische Betriebstechnik - Heinrich Von Kleist - Spi Plastics Engineering Handbook Of The Society Of The Plastics Industry Inc - Vertrauen Verfassung Und Demokratie - Tag Und Woche Monat Und Jahr - Kommunikation Und Verstndigung - Wir Sind Die Marsmenschen - Shock Waves In Materials Science - Genetic Engineering 3 - Kombinationstherapie Der Herzrhytmusstrungen Mit Chinidin Und Verapamil - Atrioventricular Conduction In Congenital Heart Disease - Informationstechnik Kompakt - Die Konstruktion Von Feindbildern - Ein Bewegtes Gelehrtenleben - Incomplete Information System And Rough Set Theory - Biology Of Antarctic Fish - Immunological Aspects Of Cancer - Einhrung In Die Wahrscheinlichkeitsrechnung Und Statistik Ingenieure - Randelementmethoden - Principles Of Statistical Radiophysics 4 - Ostmitteleuropa Ruyland Und Die Osterweiterung Der Nato - Palozoologie - Klinische Infektionslehre - Der Beckenboden Der Frau - Das Kuratorium Unteilbares Deutschland - Das Methoden-repertoire Von Lehrern - Deutsches Leben Zur Zeit Der Schsischen Kaiser - Bilder Und Skizzen Aus Der Geschichte - Arsenic And Rice - Die Manen Oder Von Den Urformen Des Totenglaubens - Handbuch Der Drogisten-praxis - Gender Methodologisch - Computerlinguistik - Mikrosoziologie - Schlsselwerke Der Geschlechterforschung - Diseases Of The Human Carotid Body - Grundlagen Der Organisation - Praxishandbuch Immobilieninvestments - Migration Und Traditionsbildung - Wahlen 2002 In Sachsen-anhalt - Human Growth Hormone - Pisa 2000 - Einhrung In Die Strmungsmechanik - Metaphern Und Gesellschaft - Zirkulre Positionen 3 - Einhrung In Die Roboterprogrammierung - Where Do You Stand - Handbuch Der Metallmrkte - Polizeipolitik In Europa - Chemical Physics Of Redox Metalloenzyme Catalysis - Current Cardiovascular Drugs - Kulturrevolution - Management Der Organisation - Human Quality Management - Die Synchronen Wechselstrommaschinen Generatoren Motoren Und Umformer Ihre Theorie Konstruktion Berechnung Und Arbeitsweise - Isostasie Und Schweremessung - Lehrbuch Der Funktionellen Diagnostik Und Therapie Der Erkrankungen Des Herzens Und Der Gefsse - Vertrauen Kooperation Netzwerkbildung - Bankgeheimnis Ade - Bilanz Mit Aussichten - Organisation Des Rundfunks - Augenpraxis Nichtspezialisten - Die Verwaltung Der Eisenbahnen - Service Ist Sexy! - The Unesco Convention On The Protection And Promotion Of The Diversity Of Cultural Expressions - Implicit Incentives In International Joint Ventures - Umweltberichterstattung Im Lokalen - Die Geburt Der Vernunft - The Mammalian Egg Coat - Statistik Informatik Und –konomie - Perspektiven Der Kultursoziologie - Jugenden Soziale Ungleichheit Und Werte - Wirklich Ein Volk - Information Und Wirtschaftlichkeit - The Training Courses Of Urological Laparoscopy - Computer Animation 90 - Zwischen Aufstieg Und Ausstieg - Funktionelle Sonographie In Gynkologie Und Reproduktionsmedizin - Advances In Human Genetics 10 - The Making Of Regions In Post-socialist Europe The Impact Of Culture Economic Structure And Institutions - Politische Integration - Enzyme Handbook 9 - Elektrische Energieerzeugung - Demokratien Des 21 Jahrhunderts Im Vergleich - Entwicklung Von Arbeitsorganisationen - Baukonstruktion Im Planungsprozess - Grundkurs Unixlinux - Demokratie Und Das Sdliche Afrika - Paediatric Pathology - Information Theory And Best Practices In The It Industry - Das 1 — 1 Des Telefonmarketing - Industrial Ecology Management - Hochbau Konstruktion - Advances In Microbial Ecology - Atomic And Nuclear Clusters - Programmieren In Lisp - Neue Aspekte In Der Therapie Mit Antiarrhythmika - Stiftungen 2011 - Die Zweite Lebenshlfte - Von Cim Zur Unternehmensintegration - Stochastic Processes - Pathways In Applied Immunology - Geographic Information Systems Spatial Modelling And Policy Evaluation - Jugend Freizeit Geschlecht - Grundlagen Der Prozesstheorie - Eine Frage Des Geschlechts - Handbuch Der Mikrochemischen Methoden - Die Przisionsbestimmung Von Gitterkonstanten Nach Der Asymmetrischen Methode - Handbuch Der Schweiytechnik - Swarms Of Ions And Electrons In Gases - Schulverweigerung - Tectonics Of The Southern Central Andes - Management Skills - Technisches Zeichnen - Wahrscheinlichkeitstheorie - Gerke Brsen Lexikon - Anerkennung Und Gewalt An Schulen - Histology Of Ancient Human Bone Methods And Diagnosis - Rechte Netzwerke Eine Gefahr - Die Reduktion Der Eisenerze - Zirkulre Positionen 2 - Grundkurs Politikwissenschaft Studium Der Politischen Systeme - Resourcing - Treatment Of Cerebral Infarction - Die Deutsche Finanzwirrnis - Die Fortschrittsfalle - Moden Als Zeitindikator - Echtzeitsysteme Und Objektorientierter Entwurf - Experteninterviews - Notflle In Gynkologie Und Geburtshilfe - Handbuch Jugendkriminalitt - Beitrge Zur Photographie Der Blutspektra Unter Bercksichtigung Der Toxikologie Der Ameisensure - Schweigen Und Verschweigen - The South Atlantic - Stdtischer Raum Und Verhalten - Benachteiligte Jugendliche In Europa - Exkursionsbuch Zum Bestimmen Der Vgel In Freier Natur Nach Ihrem Lebensraum Geordnet Laien Und Fachleute - Die Wurzeln Der Westdeutschen Nachkriegsdemokratie - Kooperation Von Jugendhilfe Und Schule - Kartelle Als Produktionsfrderer - Chemical Elements In The Environment - Parasiten Des Menschen - Die Konstruktion Des Kindes - Fourier-optik Und Holographie - Arteriosklerose - Op-pflege Prfungswissen - Brain And Behavior In Child Psychiatry - Venous Valves - Grundkurs Theoretische Physik - Petroleum Formation And Occurrence - Cellular And Molecular Alterations In The Failing Human Heart - Distributive Justice And Inequality - Crm Den Mittelstand - Knigin Luise - Die Arbeitszeitermittlung Der Verzahnungsarbeiten - Vom Obrigkeitsstaat Zur Entgrenzten Politik - Kolloidchemische Grundlagen Der Textilveredlung - Breast Cancer 4 - Die Klinik Der Tuberkulose Erwachsener - Generationen Und Sozialer Wandel - Georgius Agricola 500 Jahre - Verkehrsrecht Und Verkehrswirtschaft - Werkstoffkunde - Die Singulre Waffe - Turbulent Shear Flows 8 - Office-based Infertility Practice - Doing Modernity - Doing Religion - Starthilfe Pharmazie - Flow And Transport In The Natural Environment Advances And Applications - Steuerrecht In Nonprofit-organisationen - Personalauswahl Im Vertrieb - Lean Management In Krankenhusern - Gabler Mlp Berufs- Und Karriere-planer It Und E-business 20062007 - Die Gleichstrommaschine Ihre Theorie Untersuchung Konstruktion Berechnung Und Arbeitsweise - Hrung Auf Distanz - Die Funktional-orientierte Demokratie - Handbuch Der Experimentellen Pharmakologie - Kinder- Und Jugendarbeit Als Bildungsprojekt - Jahrbuch Der Preuyischen Forst- Und Jagdgesetzgebung Und Verwaltung - Kulturpdagogik - Living With Paradoxes - Analyse Und Simulation Elektronischer Schaltungen - Adult T Cell Leukemia And Related Diseases - Der Konstitutionstypus - Eisenbahnausrstung Der Hfen - The First Twelve Weeks Of Gestation - Musiksoziologie In Der Bundesrepublik Deutschland - Solvomercuration Demercuration Reactions In Organic Synthesis - Feuerungstechnik Mit Steinkohlen Oberschlesiens - Nonlinearities In Action - Soziologie Im Nationalsozialismus Zwischen Wissenschaft Und Politik - Politik In Sachsen - Verwaltung Und Vernetzung - Marine Geology And Oceanography Of The Arctic Seas - Der Vestibulre Nystagmus Und Seine Bedeutung Die Neurologische Und Psychiatrische Diagnostik - Eine Einladung In Die Mathematik - Grundkurs C++ In Beispielen - Current Topics In Contact Dermatitis - Justizberichterstattung - œbertragungsverhalten Analoger Schaltungen - Six Sigma+lean Toolset - Technischer Lehrgang Kupplungen - Sturgeon Fishes - Lectures On Developmental Physiology - X-ray Microscopy - Grundzge Der Rntgendiagnostik - Kommunalpolitik In Den Deutschen Lndern - Die Chirurgischen Indikationen In Der Nervenheilkunde - Die Rztliche Ausbildung In Der Europischen Gemeinschaft - Dampfkesselschden Ihre Ursachen Verhtung Und Nutzung Die Weiterentwicklung - Weltlage - Rhizodeposition Und Stoffverwertung - Neutrino Physics - Software-praktikum - Primary Bone Tumors And Tumorous Conditions In Children - Zeitgenssische Amerikanische Soziologie - Erfolgreiches Depotmanagement - Abstimmungskampagnen - Bone Transplantation - Wirtschaftsstatistik Im Bachelor - Das Sldnerwesen - Parteien Unter Druck - Arbeit In Interkulturellen Teams - Die Dampflokomotive - Handbuch Des Maschinenwesens Beim Baubetrieb - Die Bundestagswahlkmpfe Der Fdp 1949 2002 - Self-leadership Und Hrung - Chemodynamics And Environmental Modeling - Schenken - Betrieb Von Elektrizittswerken - Schlechthin Bse - Wirtschaftswachstum Strukturwandel Und Dynamischer Wettbewerb - Advances In Metal Processing - Auf Dem Weg Zum Nullemissionsgebude - Neue Wege Der Betrieblichen Planung - Computed Tomography Anatomy And Morphometry Of The Lower Extremity - Furniere Lagenhlzer Und Tischlerplatten - Gehirnkrankheiten - Jugend Und Gewalt - Rationalisierung Disziplinierung Und Differenzierung - Der Kampf Um Das Sozialistengesetz 1878 - Die Beziehung Von Unternehmenskultur Und Unternehmensmarke - Physik Und Umwelt - Advances In Human Genetics - Radionuclide - Regel-transduktoren - Physical Processes In Estuaries - Professionelle Vertriebspower Im Maschinen- Und Anlagenbau - Electron Paramagnetic Resonance Of Exchange Coupled Systems - Ergebnisse Der Inneren Medizin Und Kinderheilkunde - Grundriy Der Ernhrungslehre - Skandal Massenarbeitslosigkeit - Acronyms And Abbreviations In Molecular Spectroscopy - The Excretory Function Of Higher Plants - Regional Science - Advertisers At Work - Multi-media Und Marketing - Statistische Methoden Der Netzplantechnik - Distributed Information Systems In Business - Gemeinntzigkeitsrecht Soziale Einrichtungen - Die Rztliche Visite - Brgerinitiativen Und Reprsentatives System - Die Fabrikation Der Feuerfesten Steine - Deutschland In Den Neunziger Jahren - Die Bewltigung Des Unplanbaren - Aushrung Potentiometrischer Analysen Nebst Vollstndigen Analysenvorschriften Technische Produkte - Die Pilon-tibial-fraktur - Heart Failure And Arrhythmias - Advances In Oceanography - Adhesion 13 - Die Ernhrung Des Menschen Mit Besonderer Bercksicht Gung Der Ernhrung Bei Leibesbungen - Innovative Personalentwicklung - Die Saponine - Bibliographie Der Verffentlichungen Ber Den Leichtbau Und Seine Randgebiete Im Deutschen Und Auslndischen Schrifttum Aus Den Jahren 1940 Bis 1954 Bibliography Of Publications On Light Weight Constructions And Related Fields In German And Foreign Literature From 1940 To 1954 - Kleists Geheimnisse - Infektise Endokarditis - E-learning In Der Beruflichen Bildung - Chancen Und Risiken Von Rohstoffinvestments - Handbuch Zur Frauenbildung - Bausteine Ein Zukunftsfhiges Deutschland - Die Entwickelung Der Automatischen Telegraphie - Das Moralische In Der Soziologie - Ausgleichsvorgnge Bei Elektrischen Antrieben - Die Pathogenen Protozoen Und Die Durch Sie Verursachten Krankheiten - Zwischen Akteur Und System - Automobilelektronik - A Practical Guide To Medicine And The Law - Mglichkeiten Und Grenzen Der Antineoplastischen Therapie - Jugendliche In Ffentlichen Rumen Der Stadt - Corba - Quantum Mechanics Using Maple - Stichwort Wahlen - Regieren Im 21 Jahrhundert Zwischen Globalisierung Und Regionalisierung - Praxis Des Cash Managements - Der Arbeiternachwuchs In Der Deutschen Maschinenindustrie - Fuzzy Methoden In Der Wirtschaftsmathematik - Landtagswahlen In Nordrhein-westfalen - Wohlfahrtspolitik Und Globalisierung - Mathematische Juwelen - Organisation 2000 - Fernseh-programme In Deutschland - Demokratisierung Von Organisationen - Ministerielle Richtlinien Der Gesetzestechnik - Wissenstransfer Deutscher Universitten - Die Kurzmeldung - Lehrbuch Der Geometrischen Optik - Kritik Des Zeitstudienverfahrens - Gasdynamik Der Verbrennung - Migrantenjugendliche Zwischen Schule Und Beruf - Instandhaltung - Rechtsextremismus In Den Usa - Der Altersprsident - Kapitalanlage Versicherungen - Strmungslehre Gasdynamik Und Aerodynamisches Laboratorium - Amerikas Eindringen In Das Europische Wirtschaftsgebiet - Programmprofile Kommerzieller Anbieter - Developments In Food Microbiology4 - Co2-laser In Der Stapeschirurgie - Internationale Umweltregime - Tragwerke Aus Aluminium - Krippenerziehung In Der Ddr - Innovation Without Rand D - Moderne Und Postmoderne - Pollution Of The North Sea - Adaptability - Optimale Stufenrdergetriebe Werkzeugmaschinen - Physicochemical Aspects Of Polymer Surfaces - Handelsgesetze Als Quelle Des Brgerlichen Rechtes - Prozessregulation In Der Rhizosphre - Soziale Pathologie - Lipids And Lipidoses - Miteinander Von Kindern Und Alten Menschen - Smarte Innovation - Bilderflut Und Sprachmagie - Volume 1 Mechanisms Of Inorganic And Organometallic Reactions - Politische Streitfragen - Die Tonuskrankheiten Des Herzens Und Der Gefsse - Armut Und Zeit - Steuerung Von Netzwerken - Grassroots-campaigning - Cerebral Blood Flow - Reengineering Fluch Oder Segen - Mathematics Today Twelve Informal Essays - Elektrophysiologische Und Vegetative Phnomene Bei Stereotaktischen Hirnoperationen - Sicherheit Und Integration In Europa - –kologische Stadtentwicklung - Ratschlge Zum Mathematischen Umgang Mit Ungewiyheit - Stochastische Automaten - Politische Theorie In Den Usa - Interaktionsqualitt Und Kundenintegrationsverhalten - Magnetic Resonance Imaging - Krieg Als Medienereignis Ii - Brennstoffe · Kraftstoffe Schmierstoffe - Der Nachrichtenwert Im Situativen Kontext - Prozesse - Female Contraception - Der Bauingenieur In Der Praxis - Qualitt In Der Sozialen Arbeit - Der Durchlaufende Trger Ber Ungleichen –ffnungen - Schadstoffe In Elektrischen Und Elektronischen Gerten - The Nordic Seas - Energiemanagement Durch Gebudeautomation - Kompetenzentwicklung Im Wandel - Soziale Und Gesellschaftliche Differenzierung - Low-power Smart Imagers For Vision-enabled Sensor Networks - Power Supply In Telecommunications - Craniofacial Surgery - Kolbendampfmaschinen Und Dampfturbinen - Easy Selling - Strahlenklima Der Erde - Geologisches Krftespiel Und Landformung - „warum Haben Sie Eigentlich Streit Miteinander - Topics In Nonlinear Physics - Die Bedingungen Ruhigen Laufs Von Drehgestellwagen Schnellzge - Jugend In Arbeit - Fracture Mechanics - Die Digitalis Und Ihre Therapeutische Anwendung - Die Klassischen Sttten Von Jena Und Jlmenau - Fachrechnen Bauzeichner - Stdtebauliches Entwerfen - Der Schlaf - Step Standard For The Exchange Of Product Model Data - Fibrinklebung In Der Herz- Gefy- Und Thoraxchirurgie - Remote Sensing Digital Image Analysis - 5-phasen-methode Der Markenbewertung - Baustelle Gegenwartsliteratur - Pharmakotherapie Und Alter - Sectional Fetal Anatomy In Ultrasound - Macht Und Moral - Dokumentaustausch In Offenen Systemen - Biochemistry And Physiology Of Visual Pigments - Modellierung Der Welt - Adolescent Parenthood - Die Ausstellung Als Marke - Die Politik Zur Deutschen Einheit - Witterung Und Klima - Digital Teleretinal Screening - Wiederverwendung Qualitativer Daten - Die Hochspannungsfreileitung - Innovative Kapitalanlagekonzepte - Betriebs-handbuch Bhr 64 Pittler-revolverdrehbnke - Die Praktische Nutzanwendung Der Prfung Des Eisens Durch „tzverfahren Und Mit Hilfe Des Mikroskopes - Lohmeyer Baustatik 2 - Technische Verbrennung Verbrennungsmotoren - Diagnostische Hmatologie - Karl Mannheims Analyse Der Moderne - Analytical Techniques Of Celestial Mechanics - Brain Anatomy And Magnetic Resonance Imaging - Effizienz Im Marketing - Die Inneren Erkrankungen Im Alter - Verhandeln Und Argumentieren - Einhrung In Die Synoptische Wetteranalyse - Die Reichsgesetzlichen Bestimmungen Ber Den Verkehr Mit Arzneimitteln Ausserhalb Der Apotheken - Ansthesiologische Besonderheiten Bei Kindern Mit Syndromen Und Seltenen Erkrankungen - Berechnung Des Kontinuierlichen Balkens Mit Vernderlichem Trgheitsmoment Auf Elastisch Drehbaren Pfeilern Sowie Berechnung Des Mehrfachen Rahmens Mit Geradem Balken Nach Der Methode Der Fixpunkte - Economic Diplomacy - Englands Zivilprozey - Controlling-praxis Erfolgreicher Unternehmen - Die Lagersttten Nutzbarer Mineralien - Erfolg Durch Innovation - Steuerstandort Groybritannien - Mathematische Modellierung - Das Art-prinzip - Blood Pressure Measurements - Die Empirisch-wissenschaftliche Sicht - Regieren In Der Bundesrepublik I - Die Dampfturbine Im Betriebe - Ifrs Kleine Und Mittelgroye Unternehmen - Leichtbaustatik - Der Streit Um Die Hochschulrahmengesetzgebung Des Bundes - Arbeit Gegen Armut - Kosten-nutzen-analyse Von Beruflicher Weiterbildung - The Economics Of Networks - Modern Methods For Epidemiology - The Hippocampus - Die Urteilsbildung In Der Psychodiagnostik - Kommunikationswissenschaft Als Integrationsdisziplin - Kernverfahrenstechnik - Handbuch Zum Dampffay- Und Apparatebau - Orale Photochemotherapie - Der Innovative Staat - Soziologische Aufklrung Als Moralische Passion Pierre Bourdieu - Einhrung In Die Experimentalzoologie - Planung Und Reporting Im Mittelstand - Pierre Bourdieus Konzeption Des Habitus - Physik-œbungen Ingenieure - Hauptwerke Der Ungleichheitsforschung - Das Altern Und Seine Beschwerden - Ausgewhlte Kapitel Aus Der Funktionenlehre - Aerodynamik Der Stumpfen Krper - Die Einphasenasynchronmotoren - Pro Nuget - Frauen- Und Mdchenprojekte - Berechnung Des Eisenbetons Gegen Verdrehung Torsion Und Abscheren - Diskursanalysen 2 Institution Universitt - Lehrbuch Der Zahnheilkunde - Elementare Geometrie Und Algebra - Die Arbeitsweise Des Gehirns Und Die Psychischen Vorgnge - Lehrbuch Der Gesteins- Und Bodenkunde - Grundlagen Der Materialwirtschaft - Strategie Genie Oder Zufall - Grundkurs Funktionentheorie - Language Engineering - Electronic Commerce - Betriebswirtschaftliche Steuerlehre - Marine Mammals And Seabirds In Front Of Offshore Wind Energy - Handbuch Nachhaltige Entwicklung - Das Vieweg Einheiten-lexikon - Bolivien Politisches System Und Reformprozess 19931997 - Das Zentralnervensystem Des Menschen - Informationssysteme Hochschulen - Kernmagnetische Resonanz - Algebraic Specifications In Software Engineering - Abdominale Ultraschalldiagnostik - Wissensmanagement Marketing Und Vertrieb - Mikrokologische Prozesse Im System Pflanze-boden - 101 Frauen Der Deutschen Wirtschaft - Treatise On Heavy Ion Science - Inszenierungen Zur Gentechnik - Digitale Bildgebende Verfahren Interventionelle Verfahren Integrierte Digitale Radiologie - Dampfturbinenschaufeln - Advances In Neurochemistry - Regelungstechnik Maschinenbauer - Gekonnt Referieren œberzeugend Prsentieren - Psychotherapie In Der Medizin - Stdtische Verkehrsplanung - Vorbereitungsmaschinen Die Weberei - Jugendliche Whler In Den Neuen Bundeslndern - Gabler Lexikon Vertrieb Und Handel - Die Lehre Vom Status Thymico-lymphaticus - Gold Metallogeny - Die Moderne Selektivschutztechnik Und Die Methoden Zur Fehlerortung In Hochspannungsanlagen - Advanced Course On Fairshape - Images In Mobile Communication - Concepts In Hypertension - Perestrojka Pass© - The Fallopian Tubes - General G©rard Und Die Pfalz - Angewandte Diskursforschung - Perspectives On Human Suffering - Expertiseforschung - Lehrbuch Der Physik - Erfahrungen Im China-geschft - Schweiyen Und Lten Mit Festkrperlasern - Fem Bei Elektrischen Antrieben 1 - Lesen Und Rechtschreiben Lernen Nach Dem Intraactplus-konzept - Anleitung Zur Bestimmung Von Mineralien - Praktische Chirurgie Des Gallensteinleidens - Arzneimittel-synthese - Die Arbeitszeitermittlung Im Werkzeugbau - Gesellschaft In Literarischen Texten - Tokolyse Und Betamimetika - Israel Gesellschaft Im Wandel - Die Groyen Regierungserklrungen Der Deutschen Bundeskanzler Von Adenauer Bis Schrder - Die Technik Der Eingriffe Am Gallensystem - Entrepreneurship Governance And Ethics - Building Construction And Design - Grundlagen Der Astrophysik - Histologie Und Mikroskopische Anatomie - Politische Parteien Im Demokratisierungsprozess - Wendehorst Bautechnische Zahlentafeln - Die Berechnung Des Waldkapitals Und Ihr Einfluy Auf Die Forstwirtschaft In Theorie Und Praxis - Bildung Und Beruf - Gender From Costs To Benefits - Weiblich Ledig Kinderlos Und Alt - Basic And Clinical Aspects Of Helicobacter Pylori Infection - Analog Integrated Circuits For Communication - Phantasie Und Realitt In Der Sptadoleszenz - Soziale Arbeit In Lndlichen Rumen - Multimedia-kommunikation - Friedrich Engels Eine Biographie - Fabrikorganisation Fabrikbuchhrung Und Selbstkostenberechnung Der Ludw Loewe And Co A-g Berlin - L-dopa-substitution Der Parkinson-krankheit - Indikation Zur Operation - Patientenwelten - Network Relationship Management - Cardiac Pathology - Soziale Stadt Zwischenbilanzen - Theorie Der Stochastischen Automaten - Edelguss - Handbuch Fahrerassistenzsysteme - Fernsehen Als „beziehungskiste - Literaturwissenschaft Und Systemtheorie - Amputationschirurgie Und Rehabilitation - Technische Mechanik Statik - Kompendium Der Augenheilkunde - Bevlkerungsfragen Auf Abwegen Der Wissenschaften - The Right Heart - Grnderprocesse - Der Integrationsgedanke In Der Betriebswirtschaftslehre - Krieg Gegen Die –ffentlichkeit - Event-marketing Und -management - Aktuelle Kernfragen In Der Psychiatrie - Die Volkskammer Der Ddr - Friedrich Wieser Als Soziologe - The Inadequate Environment - Wozu Experten - Molekularakustik - Vom Bankberater Zum Beziehungsmanager - Disney Stories - Dbase Iv Einsatz In Lokalen Netzwerken Lan - Die Zukunft In Amerika - Bildung Die Einwanderungsgesellschaft - Protest-inszenierungen - Das Ja Zur Politik - Die Zweckmssigkeit In Der Entwicklungsgeschichte - Cobol - Die Frage Der Verstaatlichung Der Kaliindustrie - Adrenergic System And Ventricular Arrhythmias In Myocardial Infarction - Quo Vadis Ct - Die Hrungsaufgabe - Opportunismus In Geschftsbeziehungen - All About Chess And Computers - Die Medizin An Der Berliner Charit© Bis Zur Grndung Der Universitt - Einhrung In Die Moderne Kinderheilkunde Ein Lehrbuch Studierende Und „rzte - Joint Ventures Im Chinesischen Kulturkreis - Hilfsbuch Raum- Und Auyenklimatische Messungen Hygienische Gesundheitstechnische Und Arbeitsmedizinische Zwecke - Verstndigungsprobleme Und Gestrte Kommunikation - Interaktive Medien Interdisziplinr Vernetzt - Persnliche Netzwerke In Stadt Und Land - Mitteilungen Der Deutschen Materialprfungsanstalten - Organisationsvielfalt Und Betriebliche Gesundheitsfrderung - Bibliographie Der Verffentlichungen Ber Den Leichtbau Und Seine Randgebiete Im Deutschen Und Auslndischen Schrifttum Aus Den Jahren 1955 Bis 1959 Bibliography Of Publications On Light Weight Constructions And Related Fields In German And Foreign Literature From 1955 To 1959 - Physik Der Ferrite Und Der Verwandten Magnetischen Oxide - Abfallwirtschaft Stoffkreislufe - Genossenschaftliche Erziehung - Interactive 3d Multimedia Content - Humor Und Sein Nutzen Sozialarbeiterinnen - Aktuelle Hrungstheorien Und -konzepte - Die Wirksamkeit Der Entwicklungshilfe - Das Wachstum Von Verwaltungsorganisationen - Selektion Im Internet - Contemporary Research In Engineering Science - Nachhaltigkeitswissenschaften - Extrakorporale Zirkulation Heute - Advances In Human Genetics 6 - Die Kohlenstoffernhrung Des Waldes - Analyse Der Harze Balsame Und Gummiharze Nebst Ihrer Chemie Und Pharmakognosie - Erfolgreiche Anzeigen - Personalbeurteilung - Die Eisenbahn - Transportsteuer Und Ihre Stellung Im Staatshaushalte - Mglichkeitssinn - Nach Dem Crash Ist Vor Dem Crash - The Collagens Biochemistry And Pathophysiology - Packen Sie An - Ellenberger-schtz Jahresbericht Ber Die Leistungen Auf Dem Gebiete Der Veterinr-medizin - œber Norbert Elias - Die –ffnung Des Staates - Stiftungsvermgen - Die Besten Manager 2009 - Wirtschafts- Rechts- Und Sozialkunde Sekretrinnen - Die Cross-methode Und Ihre Praktische Anwendung - Leitfaden Der Therapie Der Inneren Krankheiten - Fdp Partei Der Zweiten Wahl - Grundlegende Algorithmen Mit Java - Trends In Control - Netze Protokolle Spezifikationen - Plant Genome Diversity Volume 1 - Social Branding - Ausgewhlte Kapitel Aus Der Technischen Strmungslehre - Ultraschallfibel Gynkologie Und Geburtshilfe - Verbrennungskraftmaschinen - Zukunftsbranche Biotechnologie - Chronische Virushepatitis Und Ihre Behandlung Mit Interferon Alfa - Migration In Und Nach Europa - Kundenclubs And More - Friedrich Engels Schriften Der Frhzeit - Gauge Theories Of The Strong And Electroweak Interaction - Die Stimme Der Medien - Unternehmerische Versicherungswirtschaft - Lexikon Der Psychiatrie - From Data To Model - Prostatic Obstruction - Die Chemie Der Trocknenden –le - Deutsche Familiensoziologie - Die Syphilis Des Zentralnervensystems - Meygerte Und Schaltungen Wechselstrom-leistungsmessungen - Typenbildung In Der Sozialwissenschaftlichen Umweltforschung - Das Fernstrassenproblem Europas - Polymer Rheology - Die Seele Im Unternehmen - Differentialgleichungen Mit Mathematica - Die Nfte Gewalt - Erweiterte Datenanalyse Mit Spss - Testosterone - Fundamentals Of Food Process Engineering - Mit Dem Kranken Partner Leben - Umweltrecht - The Rust Fungi Of Cereals Grasses And Bamboos - Geowissenschaften Und Umwelt - Der Professionelle Lehrer - Systemwechsel Und Demokratisierung - Photodegradation Of Polymers - Geschichte Der Sozialen Ideen In Deutschland - Perspektiven Der Telekommunikationspolitik - New Advances In Histamine Research - Objektorientierte Programmierung Mit Turbo Pascal - Biofouling Bei Membranprozessen - Mnnlichkeiten Gemeinschaften Nationen - Evolving Strategies And Tactics In Membrane Research - Modell Zur Bewertung Wohnwirtschaftlicher Immobilien-portfolios Unter Beachtung Des Risikos - Metriken - Der Schlssel Zum Erfolgreichen Security Und Compliance Monitoring - Der Besitz Venetiens Und Die Bedeutung Des Neu-italischen Reiches - Ausbildungsreife - Fortschritte Der Elektrokardiologie 1963 Und 1964 - Praktische Doppler-sonographie - Partitionierung Zur Effizienten Duplikaterkennung In Relationalen Daten - Die Physikalischen Grundlagen Der Anwendung Radioaktiver Oder Stabiler Isotope Als Indikatoren - Demokratie In Der Kleinstadt - Kompendium Der Statik Der Baukonstruktionen - Analog Circuit Design For Process Variation-resilient Systems-on-a-chip - Grundriss Des Kaufmnnischen Rechtes - Moderne Soziologische Theorien Und Sozialer Wandel - Atm Networks - Systemtheorien Im Vergleich - Grundkurs Biomathematik - Differentialdiagnose Der Herztne Und Herzgerusche - Mediastinale Sonographie - Chemie Und Struktur Der Pflanzen-zellmembran - Die Werksgemeinschaft In Historischer Und Soziologischer Beleuchtung - Wissen Managen Mit Innovativer Informationstechnologie - Acht- Und Neunstellige Tabellen Zu Den Elliptischen Funktionen Eight And Nine Place Tables Of Elliptical Functions - Aktuelle Neuropdiatrie 1991 - Technikethik Und Wirtschaftsethik - Kostbarkeiten Aus Dem Deutschen Apotheken-museum Heidelberg Treasures From The German Pharmacy Museum Heidelberg - Medical Textiles For Implantation - Die Grund- Und Endprobleme Der Erkenntnis - Document Architecture In Open Systems The Oda Standard - Prfungsvorbereitung Industriekaufleute - Therapie Mit Gallopamil - Der Flotations-prozess - Technische Mechanik Kinematik Und Kinetik - Flows Of Faith - Leitfaden Der Mechanik Maschinenbauer Mit Zahlreichen Beispielen Den Selbstunterricht - Brain-stem Localization And Function - Selbstheilung Von Der Sucht - Ergebnisse Und Probleme Der Elektronentheorie - Kulturbetriebslehre - Postharvest Biotechnology Of Flowers And Ornamental Plants - Politik Und Wirtschaftswachstum - Altersbilder In Der Professionellen Altenpflege - Textoptimierung Printmedien - Die Enttuschten Revolutionre - Physik Des Ultraschalls - Technische Anwendungen Des Lasers - Ultraschall In Der Chirurgie - From The Atomic Bomb To The Landau Institute - Die Holzbaukunst - Forest Dynamics - Spezielle Chirurgie - Global Events And Event Stratigraphy In The Phanerozoic - Childhood Tuberculosis Modern Imaging And Clinical Concepts - Kollegialitt Und Kooperation In Der Schule - Finanzinnovationen - Brgschaft Des Inneren Friedens - Soziale Hilfe Ein Teilsystem Der Gesellschaft - Die Krebskrankheit - Innovative Landtage - Grundlagen Der Orthopdischen Mechanik - Die Kunst Der Klugheit - Morphology And Function In Mri - Karrieremanagement - Agricultural Project Management - Wozu Politische Theorie - Die Quellen - Konflikte Und –ffentlichkeit - Demokratie Und Internet - Das Interpretative Paradigma - Global Environmental Security - Lungen- Und Rippenfellentzndung - Die Neuen œbereinkommen Ber Den Internationalen Eisenbahnverkehr - Hemocoagulative Problems In The Critically Ill Patient - Finanz- Und Versicherungsmathematik - Fortschritte Der Praktischen Geologie Und Bergwirtschaft - Jahresbericht Ber Die Beobachtungs-ergebnisse - Ein Jahrhundert Deutscher Maschinenbau - Stochastische Optimierung - –kologische Gebudetechnik - Allgemeine Wirtschaftslehre Broberufe - Klinische Rheumatologie - Auslndische Jugendliche In Der Berufsausbildung - Das Managementmodell Der Jesuiten - Betriebswirtschaftslehre Den Bankkaufmann - Angewandte Atomphysik - Brennpunkt Plenum - Faszination - Energieversorgung Probleme Und Ressourcen - Studien- Und Forschungshrer - Im Schatten Demokratischer Legitimitt - Problemkreis Altlasten - Burnout Aus Ressourcenorientierter Sicht Im Geschlechtervergleich - Die Elektrolytischen Metallniederschlge - Nachhaltige Entwicklung In Industrie- Und Bergbauregionen Eine Chance Den Sdraum Leipzig - Mythos Globalisierung - Die Frberei Und Bleicherei Der Gespinnstfasern - Die Konomische Analyse Von Kommunikationsbeziehungen In Organisationen - New Concepts In Viral Heart Disease - Steuerfall Und Lsung - Moral Und Recht Im Diskurs Der Moderne - History Of Free Skin Grafting - Die œberhrung Kommunaler Betriebe In Die Form Der Gemischt Wirtschaftlichen Unternehmung - Unfall- Und Wiederherstellungschirurgie Des Schultergrtels - Muscle Transplantation - Muslimische Patienten Pflegen - Eine Kurze Einhrung In Die Systemtheorie - Physik In œbungsaufgaben - Europa 2020 - Trends In Research And Treatment Of Joint Diseases - Das Giessen Von Messingblcken - Programmieren In C - Self Ego And Identity - The Mathematics Of Computerized Tomography - High Value Management - Verstehen Und Kultur - Der Anomische Staat - Lehrbuch Der Mathematik - Pediatric Metabolic Syndrome - Gegenwrtige Zuknfte - Sicherheit In Der Unsicheren Gesellschaft - Umweltrisiko Und Raumentwicklung - Ozon - Wirtschaftliche Rationalitt - The Fallopian Tube - Das Wahrheitsproblem Und Die Idee Der Semantik - Drogen Und Stadtstruktur - Holzsysteme Den Hochbau - Der Schlaf Seine Strungen Und Deren Behandlung - Advanced Methods In Computer Graphics - Survival-guide Chirurgie - Kinderradiologie 1 - Leitfaden Zur Eisenhttenkunde - Diamantbohrungen Schrf- Und Aufschluyarbeiten Ber Und Unter Tage - Endoskopie Postoperativer Syndrome - Progressive Muskeldystrophie Myotonie · Myasthenie - Bauphysik - Autocad-aufbaukurs - Festigkeitsberechnung Rotierender Scheiben - Die Hochdrucklokalansthesie - Frauenerwerbsttigkeit In Geschlechterregimen - Wachsende Stadt - Datenverarbeitung In Der Empirischen Sozialforschung - Das Mensch-tier-verhltnis - Scanning Electron Microscopy In Biology - Jahrbuch Medienpdagogik 1 - Middleware - Berufsfindungsprozesse Von Mdchen Und Jungen Frauen - Projektmanagement Als Organisationales Lernen - Kardiales Risiko Beim Sport - Der Strategie-scout - Biologische Restabfallbehandlung - Aussagefhigkeit Und Aussagewilligkeit Von Probanden Bei Der Conjoint-analyse - Essential Hypertension - Diagnostik Und Therapie Der Lungen- Und Kehlkopftuberkulose - Betriebswirtschaftslehre Und Recht - Didaktik Der Journalistik - Qualittszirkel Erfolgreich Gestalten - Technische Thermodynamik - Tragende Kunststoffbauteile - Hilft Die Entwicklungshilfe Langfristig - Regulation Of Coronary Blood Flow - Information Und Entscheidung - Staat Und Medien - Engagement Die Erwachsenenbildung - Journalismus And Kompetenz - Peter Weiss Jahrbuch 3 - Lern- Und Leistungsmotivation - Wohlfahrtsstaat Transformation Und Perspektiven - Die Physikalischen Und Technischen Grundlagen Der Hochfrequenzbehandlung - Urosonographische Differentialdiagnose - Fossil And Recent Sponges - Optionsscheine Optionen Und Futures - Human Development And Health - Werte Wettbewerb Und Wandel - Patchwork-jugend - Der Mensch Im Merger - Die Gruppendiskussion In Der Marktforschung - –kologische Krise Und Marktmechanismen - Die Grundlagen Der Relativittstheorie - Maynahmen Und Programme Gegen Rechtsextremismus Wissenschaftlich Begleitet - Psychophysics In Action - Biomaterials For Surgical Operation - Die Feinplanung Von Dv-systemen - Allgemeine Diagnostik Und Therapie Der Hautkrankheiten - Nachhaltige Nutzung Von Wrmeenergie - Demokratie Und Partizipation - Familie Arbeit Kinderbetreuung - Praxiswissen Radar Und Radarsignalverarbeitung - Einwanderung Im Spiegel Sozialwissenschaftlicher Forschung - Walsh-funktionen Ingenieure Und Naturwissenschaftler - Computed Tomography And Magnetic Resonance Tomography Of Intracranial Tumors - Zukunftssicherung Die Bauwirtschaft - Magnetische Induktion In Eisen Und Verwandten Metallen - Bauwerksabdichtung In Der Altbausanierung - Starthilfe Finanz- Und Rechnungswesen - Die Dynamische Produktion - Employer Branding - The Sages Manual - Handbook Of Research On Student Engagement - Gendered Profession - Statistical Theory Of Heat - Netzwerk Weltpolitik - Integration Durch Verfassung - Algebra I - Sozialstruktur Und Milieuerfahrungen - Cranial Meningiomas - Gehltes Wissen Als Emotional-krperbezogene Ressource - Starthilfe Technische Mechanik - Lehren Lernen Und Fachdidaktik - Gicht Und Rheumatismus - Methoden Der Diagnostischen Hmatologie - Heute Akquirieren - Sofort Profitieren - Abschied Von Der D-mark - Die Asynchronmotoren Und Ihre Berechnung - Mobilmachung Im Mittelstand - Handlung Und Kompetenz - Re-design Von Wertkette Durch Make Or Buy - Grundkurs Wirtschaftsmathematik - Raum Zeit Medialitt - An Den Rndern Der Deutschen Hauptstadt - Dauer Und Abbau Der Kriegswirtschaft - Die Rechtsabteilung - Vektoranalysis - High Precision Navigation - Der Wandel Des Franzsischen Parteiensystems - Soziologie Im Konzert Der Wissenschaften - Zwei Kulturen - Konzeptionen Gegen Jugendarbeitslosigkeit - Die Nachkalkulation Nebst Zugehriger Betriebsbuchhaltung In Der Modernen Maschinenfabrik - Personalentwicklung Im Wandel - Geschichte Und Struktur Des Deutschen Parteiensystems - Postmoderne Kultur - Organisationstheorie - International Yearbook Of Nephrology 1992 - Die Freien Hauttransplantationen - Phase Structure Of Strongly Interacting Matter - Object-oriented Programming - Endosonography In Obstetrics And Gynecology - The Impact Of Performance Budgeting On Public Spending In Germanys Laender - Sozialdemokratische Reformdiskurse - Anders Leben - Anders Sterben - Blutungskrankheiten - Frieden Als Form - Entkriminalisierung - Der Eisenbeton-schiffbau - Advances In Fluid Mechanics And Turbomachinery - Hren Lernen - Gram-negative Bacterial Infections And Mode Of Endotoxin Actions - Human Lactation 2 - Experimental Psychology Cognition And Human Aging - 22 Deutscher Soziologentag 1984 - Stochastik Der Strahlenwirkung - Nachhaltigkeitscontrolling - Neue Soziale Bewegungen - Analysis Of Solids In Natural Waters - Friedensengel Im Kampfanzug - Agil Macht Stabil - Frickknll Baukonstruktionslehre 2 - Die Individualisierungs-these - Die Berechnung Der Anlay- Und Regelwiderstnde - Algebra Und Diskrete Mathematik Informatiker - Schrder Gegen Stoiber - Grundlagen Der Cmos-technologie - Der Steuerungs- Und Wohlfahrtsstaat Deutschland - Der Alltgliche Politikunterricht - Handbuch Kindheits- Und Jugendforschung - Endokrine Und Stoffwechselkrankheiten - Immunotherapeutic Prospects Of Infectious Diseases - Interdisciplinary Applications Of Kinematics - Lan Lokale Pc-netzwerke - Governance Von Schul- Und Elementarbildung - Die Prfung Der Chemischen Reagentien Auf Reinheit - Concurrency And Nets - Fractures Of The Acetabulum - Netzwerk- Und Datensicherheit - Die Neueren Arzneimittel Und Die Pharmakologischen Grundlagen Ihrer Anwendung In Der Rztlichen Praxis - Massen-tafeln Zur Bestimmung Des Gehaltes Stehender Bume An Kubikmetern Fester Holzmasse - Zeit Und Arbeit - Starthilfe Physik - Hydraulik Bauingenieure - Die Hchste Nerventtigkeit Das Verhalten Von Tieren - Forststhetik - Affektive Strungen - Helicobacter Pylori And Gastroduodenal Pathology - Organic Chemistry Of The Earth Atmosphere - Kapitalismus Und Sozialismus - Serien-welten - Anatomie Des Menschen - Neue Kommunikationsnetze - Gold And Other Precious Metals - Politische Kultur In Stdtischen Rumen Parteien Auf Der Suche Nach Whlern Und Vertrauen - Soziale Lage Und Lebensstil - Politische Akteure In Der Mediendemokratie - Einhrung In Das Prfungs- Und Revisionswesen - Grundlagen Der Informatik Ingenieure - Investmentrecht - Bildungskontexte - Sonnenkollektoren - Jugend Rechtsextremismus Und Gewalt - Biologische Daten Den Kinderarzt - Embryologie Und Fortpflanzungsbiologie Der Angiospermen - Grundlagen Des Maschinellen Beweisens - Kurze œbersichtstabelle Zur Geschichte Der Medizin - Masterkurs Wirtschaftsinformatik - Sensoren In Wissenschaft Und Technik - Regierungssystem Und Verwaltungspolitik - Die Gemischbildungen Der Gasmaschinen - Grundlegende Begriffe Der Mathematik Entstehung Und Entwicklung - Der Aufbau Der Kupfer-zinklegierungen - Holznahrung Und Symbiose - Multikulturalismus Und Political Correctness In Den Usa - Herzerkrankungen Und Interventions-mglichkeiten - Arbeitsbuch Mathematik Ingenieure Band Ii - Antriebstechnik In Der Metallverarbeitung - Familie Als Beruf Arbeitsfeld Der Zukunft - Abgrenzung Und Bewertung Von Vermgensgegenstnden - Die Extreme Rechte In Der Bundesrepublik - Jakob Michael Reinhold Lenz - Handbuch Biologische œbungen - Das Prdikat Im Deutschen - Gewinnen Strategien Mathematische Spiele - A Longitudinal Study Of Adolescent Growth - Zur Theorie Des Absatzes - Leichtbau-konstruktion - Die Fragmentierung Des Medienpublikums - Fundamentals Of Continuum Mechanics Of Soils - Das Bayernwerk Und Seine Kraftquellen - Zeigt Mir Was Ihr Knnt! - Geschlechter - Elektrokonvulsionstherapie Kompakt - Chefentlastung - Gottfried Benn Rainald Goetz - Patent Filing Strategies And Patent Management - Grundlagen Der Fabrikorganisation - Endoprosthetics - Sozialstruktur Im Umbruch - Kunden Auf Dauer Binden - Moderne Probleme Der Metallphysik - Lobbyismus Im Klimaschutz - Soziologische Aufklrung 3 - Der Durchlaufende Bogentrger Auf Elastischen Sttzen Mit Und Ohne Versteifungstrger - Unternehmens-it Banken - Die Internet-galaxie - Relationship Banking - The Effect Of Fluorine-containing Emissions On Conifers - Asphaltstrayen Und Teerstrayen - The Mathematical Foundation Of Structural Mechanics - Jugendarbeit In Groystdten - Ultrasonography Of The Spleen - Beratung Von Organisationen - –ffentliche Sozialforschung Und Verantwortung Die Praxis - Das Reichsgesundheitsamt 18761926 - Kohlenwirtschaftsorganisationen - Schwingungen In Natur Und Technik - Advances In Superconductivity Vi - Einheit Durch Vielfalt - Das Dilemma Des Modernen Mannes - Excel 40 - Problemfall Deutsche Einheit - Reducing Co2 Emissions - Kleines Fachbuch Der Kakaoerzeugnisse - Web-programmierung - Dokumentationsverfahren In Der Herzchirurgie - Lernstrungen Und Hirnfunktion - Weltanschauliche Erziehung In Der Ddr - Biomechanics In Orthopedics - Konstitutionspathologie In Der Ohrenheilkunde - Einfluyfelder Orthogonal Anisotroper Platten Influence Surfaces Of Orthogonal Anisotropic Plates - Soziale Arbeit In Der Sozialhilfe - Mitarbeiterzeitschriften Noch Besser Machen - Kfz-rechnen - Soziale Kommunikation - A Spider Web - Reflexiver Sprachgebrauch - Medien-ethik - Micromounts - Kleben - Erfolgreich Und Fehlerfrei - Die Grundlagen Der Hochfrequenztechnik - Der Gift- Und Farbwaaren-handel - Hydromechanik Der Gerinne Und Kstengewsser - Das Vieweg Latex2ε-buch - Gabler Lexikon Auslands Geschfte - Erkrankungen Der Kieferhhle - Corporate Agility Organization - Personalarbeit Der Zukunft - Introduction To Robotics - Butter · Kse Milchprparate Und Nebenprodukte - Remote Sensing An Operational Technology For The Mining And Petroleum Industries - Die Frderung Von Massengtern - Die Wiehler Urgroymutter Und Ihre Verwandtschaft - „mit Nfzehn Hat Es Noch Trume … - Dampfturbinenkraftwerke Kleiner Und Mittlerer Leistung - Empirische Policy- Und Verwaltungsforschung - Formeln Und Lehrstze Zum Gebrauche Der Elliptischen Functionen - Die Gegenwrtigen Behandlungswege Der Kieferschussverletzungen - Der Konstruktive Fortschritt - „rockmobil - X-ray And Neutron Diffraction In Nonideal Crystals - Kriminaltaktik Mit Besonderer Bercksichtigung Der Kriminalpsychologie - Simulation Von Rhrenverstrkern Mit Spice - Introduction To Abdominal Ultrasonography - Dampfkessel-feuerungen Zur Erzielung Einer Mglichst Rauchfreien Verbrennung - Intelligent Software Agents - Theorie Der Informationsbertragung - Wer Dient Verdient! - Die Konservierung Von Knochengewebe Transplantationen - Fallsammlung Wirtschaftslehrewirtschaftsrechnen - Metal Ions In Neurological Systems - Ressourcenorientierte Netzwerkmoderation - „meine Frau Managt Das Ganze Leben Zu Hause - Die Einfachen Zuckerarten Und Die Glucoside - Sap R3 Kommunikation Mit Rfc Und Visual Basic - Feministische Kommunikations- Und Medienwissenschaft - Begriffsbildung Und Theoriestatus In Der Friedensforschung - Clays In Crustal Environments - Perspektiven Auf Kindheit Und Kinder - Infinite Horizon Optimal Control - –kologische Aufklrung - Essential Hypertension 2 - Die Corporate Social Responsibility-politik Der Europischen Kommission - Programmierhandbuch Den Ibm Pc - Tragwerkslehre - 27 Kongrey Der Deutschen Gesellschaft Soziologie Gesellschaften Im Umbruch - Qualittssicherung Durch Softwaretests - Analysis 1 - Effektive Sicherheit - The Causation And Clinical Management Of Pelvic Radiation Disease - Kinderradiologie 2 - Themen Der Rechten Themen Der Mitte - Die Energiefrage - Praktische Mathematik - Soziale Gerontologie Und Sozialpolitik Ltere Menschen - Spannbetontrger - Griechische Kriegsaltertmer Hhere Lehranstalten Und Den Selbstunterricht - Aufgaben Und Fortschritte Des Deutschen Werkzeugmaschinenbaues - Kreiselpumpen - Lineare Algebra Und Lineare Programmierung - Entwicklung Und Sozialisation Von Jugendlichen Vor Und Nach Der Vereinigung Deutschlands - Kundenforum - Kindheit In Armut Weltweit - Der Elastisch Drehbar Gesttzte Durchlaufbalken Durchlaufende Rahmen Gebrauchsfertige Zahlen Einfluylinien Und Grytwerte Der Momente - Die Grundlagen Den Vergleich Von Wrmeschutzangeboten - Das Berufsbildungssytem In Deutschland - Ohne Gewhr - Managen Mit Methode - Kinderpsychotherapie In Der Praxis - Physik Im Lehrbuch 17001850 - Kenntnis Der Wasch- Bleich- Und Appreturmittel - Ein Biychen Feministisch Anwendungsorientierte Sozialforschung - Berufs- Und Karriereplaner Erneuerbare Energien - Einhrung In Die Halbleitertechnologie - Neuroradiology - Technische Berichte - Angewandte Phnomenologie - Kolonisierung Oder Integration - Migration Und Schulischer Wandel Leistungsbeurteilung - Atlas Zur Spurenkunde Der Elektrizitt - Numerik Symmetrischer Matrizen - Phnomenologie Und Soziale Wirklichkeit - Zwischen Alltag Und Utopie - Handbook Of Recording Engineering - Pain And Kampo - Scientific Computing In Chemical Engineering - Bildung Nachhaltige Entwicklung - Wasserkonflikte Sind Machtkonflikte - –kologische Kompetenz - Die Arometer-methode Zur Bestimmung Der Kornverteilung Von Bden Und Anderen Materialien - Der Heutige Stand Der Chemotherapeutischen Carcinomforschung - Das Wagenbereinkommen Des Vereins Deutscher Eisenbahnverwaltungen Und Seine Wirthschaftliche Bedeutung - The House Mouse - Elektro-fachzeichnen 1 - Berechnung Und Aushrung Der Hochspannungs-fernleitungen - Managerherrschaft In Deutschland - Praxisorientiertes Online-marketing - Migration Im Wettbewerbsstaat - Die Zeitung Zwischen Print Und Digitalisierung - In Die Tiefen Des Weltalls - Die Kosten Der Parteiendemokratie - Unternehmensdynamik - Sprachkompetenz Tageszeitungsnutzung Und Politikorientierung Von Einwanderern - Biographische Erziehungswissenschaft - Die Wertheim-studie - Pro Spring 3 - Soziologische Aufklrung 5 - Signalbertragung - Qualitative Forschung - Gabler Lexikon Sekretariat International - Image Transfer Through A Scattering Medium - –ffentliche Meinung Und Politik - Progress In Regional Cancer Therapy - Elektrotechnik Maschinenbauer - Hydraulic Machinery And Cavitation - Abc Des Molkereilaboratoriums - Einhrung In Die Historisch-vergleichende Soziologie Max Webers - Das Maschinen-zeichnen - Strategisches Management - Imaging Of The Brain In Psychiatry And Related Fields - Die Internationale Bauausstellung Emscher Park - Die Materialprfung Der Isolierstoffe Der Elektrotechnik - Explosion Pipes - Kraftmaschinen Und Arbeitsmaschinen - The Tropical Rain Forest - Sozialitt In Slow Motion - Die Prfung Der Textilien - Der Reiz Des Trivialen - Heterogenitt - Diversity - Intersektionalitt - Milde Hypertonie - Blutkrankheiten Und Blutdiagnostik - Engineering Tables And Data - Trkische Unternehmensgrndungen Von Der Nische Zum Markt - Die Mannich-reaktion - Politikwissenschaft In Der Bundesrepublik Deutschland - Morphology Of The Rocky Members Of The Solar System - Ion Tracks And Microtechnology - First Class - Parteien Und Parteimitglieder In Der Region - Proceedings Of The Twelfth International Conference On The Physics Of Semiconductors - Open Innovation In Life Sciences - Redefining The Process Of Retirement - Fallarbeit In Der Universitren Lehrerinnenbildung - Die Eigenschaften Des Betons - Immunglobuline In Der Klinischen Neurologie - Leib Krper Und Identitt - Research Techniques For High Pressure And High Temperature - Einhrung In Die Stadtplanung 3 - Produktions-management - Drogisten-lexikon Ein Lehr- Und Nachschlagebuch Drogisten Und Verwandte Berufe Chemotechniker Laboranten Groyhandel Und Industrie - Soziologische Theorie Und Geschichte - Die Fabrikation Der Soda Nach Dem Ammoniakverfahren - Chemie Der Menschlichen Nahrungs- Und Genussmittel - Creo Parametric 20 Einsteiger - Kurz Und Bndig - Elektro-fachkunde - Die Rntgentechnik In Diagnostik Und Therapie - Interaktionsplattformen Und Kundenintegration In Industriegtermrkten - Methods Of The Classical Theory Of Elastodynamics - Adapting Historical Knowledge Production To The Classroom - Ludwig Boltzmann Principien Der Naturfilosofi - Robert Michels Soziologie Des Parteiwesens - Incidental Carcinoma Of The Prostate - Almanach Der Praktischen Ethik - Himmelsfotografie Mit Schmidt-teleskopen - Einhrung In Die Mathematik Studenten Der Wirtschaftswissenschaften - 3d Geoscience Modeling - Die Humorale Steuerung Der Erythropoiese - Lehrbuch Der Bauphysik - Control And Automation In Anaesthesia - Der Kaprizise Ellbogen - Politische Identitt Und Nationale Gedenktage - Leitfaden Der Din Normen - Genetics Of Influenza Viruses - Jugend In Ostdeutschland Lebenssituationen Und Delinquenz - Das Wesen Des Lichts - Assisted Circulation 4 - Moderne Vakuumelektronik - Biologische Auswertungsmethoden - Technisches Optimieren - Turbulent Shear Flows 7 - Functional Morphology Of Neuroendocrine Systems - Endosonography In Gastroenterology Gynecology And Urology - Grundwissen Experimentalphysik - Stakeholdermanagement In Der Unternehmenskrise - Theorietechnik Und Politik Bei Niklas Luhmann - Theorie Der Institution - Aufgaben Aus Der Maschinenkunde Und Elektrotechnik - Tof Range-imaging Cameras - Police Research In The Federal Republic Of Germany - Allergische Diathese Und Allergische Erkrankungen - Ion Implantation In Semiconductors - Dosimetrie Der Strahlungen Radioaktiver Stoffe - Eisenbahn Und Kraftwagen - Molecular Theory Of The Living Cell - Sozialer Raum Und Soziale Arbeit - Psychotherapie Als Transformationsprozey - Handbuch Die Bekleidungsindustrie Und Den Bekleidungs-einzelhandel - Waren Und Dienste - Finite Element Programs For Structural Vibrations - Wirtschaftsspionage Und Intelligence Gathering - Medical Parasitology - Power In Procurement - Der Edisonakkumulator - Die Aussichten Von Zwanglaufkesseln - Demenz - Recombinant Human Erythropoietin Rhepo In Clinical Oncology - Radioforschung - Biological Effects Of Polynucleotides - Urinary Cytology - Haarkrankheiten Und Kosmetische Hautleiden - Quantitative Social Research In Germany And Japan - Neue Steuerungsmodelle Frischer Wind Im Jugendhilfeausschuss - Die Berechnung Von Steifrahmen Nebst Anderen Statisch Unbestimmten Systemen - Planung Und Optimierung Von Rechnernetzen - Ganztagsschule - Tumormarker - Machtfaktor Auch Ohne Machtbasis - Das Modell Deutschland Auf Dem Prfstand - Betrachtungen Eines In Deutschland Reisenden Deutschen - Soft Skills Freelancer - Intracranial And Intralabyrinthine Fluids - Psychoanalyse In Der Weiterbildung - Die Selbstttige Regelung Elektrischer Maschinen - Elitenvertrauen Und Demokratie - Klausurtraining Technische Mechanik - Herzerkrankungen - Umweltgerechte Verkehrskonzepte - Das Einrichten Von Automaten - Anatomie Des Menschen Ein Lehrbuch Studierende Und „rƶte - Felix Hausdorff Zum Gedchtnis - Die Parteien Nach Der Bundestagswahl 1998 - Deutsche Ungarnpolitik 19391941 - Medienkompetenz - Linguistische Datenverarbeitung - Die Unternehmer-elite - Das Verchromungs-verfahren - The Influence Of Antibiotics On The Host-parasite Relationship Iii - Das ‘webersche Moment - Das Selbst Im Netz - Friedhofsgesprche - Thermodynamische Eigenschaften Umweltvertrglicher Kltemittel Thermodynamic Properties Of Environmentally Acceptable Refrigerants - Vetospieler In Der Policy-forschung - Rotordynamics Of Automotive Turbochargers - Kindgemyheit Im Kontext - Eskalation Durch Berichterstattung - Autarkie Und Anpassung - Nebenwirkungen In Der Onkologie - Motivation Und Begeisterung - Stadt Und Arbeitslosigkeit - 50 Jahre Kongress Innere Medizin 18821932 - Manual Of Pelvic Surgery - Zum Werk Leonhard Eulers - Joseph Alois Schumpeter - Lebenslagen Soziale Ressourcen Und Gesellschaftliche Integration Im Alter - Terminalserver Mit Citrix Metaframe Xp - Virology And Immunology In Multiple Sclerosis Rationale For Therapy - Hyperbolic Equations And Waves - Bschungen Und Baugruben - Multisensuelle Unternehmenskommunikation - Die Theorie Elastischer Gewebe Und Ihre Anwendung Auf Die Berechnung Biegsamer Platten - Treatment With Gallopamil - Nichtlineare Optimierung - Reaktivierungsmanagement Von Not Leidenden Unternehmen - Lehrbuch Der Physiologischen Chemie - Neurogenetik - Management Im Vernetzten Unternehmen - Bild Und Wirklichkeit - Staatenkooperation In Der Eu Und Darber Hinaus - Die Ampullenfabrikation - Junge Frauen Heute Wie Sie Leben Was Sie Anders Machen - Ingenieurmechanik - Die Psychologie Des Menschen Im Flugzeug - Gerontology - Verteilte Systeme Unter Unix - Soziale Netze Und Soziale Untersttzung Alleinerziehender Frauen - A Practitioners Guide To Prescribing Antiepileptics And Mood Stabilizers For Adults With Intellectual Disabilities - Cerebral Ischemia And Basic Mechanisms - Reliability Evaluation Of Power Systems - Kompakt-lexikon Umwelt- Und Wirtschaftspolitik - Regionen Und Netzwerke - Menschenrechtserziehung In Der Schule - Politik Und Bedeutung - Prolegomena Einer Medizinischen Anthropologie - Summarizing Information - Der Kugeldruckversuch Nach Brinell Die Hrteprfung Mit Vorlast Und Die Hrteprfung Nach Vickers - Java-grundkurs Wirtschaftsinformatiker - A Handbook For Clinical Teachers - Dein Mutmacher Bist Du Selbst! - Physical Processes In Comets Stars And Active Galaxies - Die Betriebswissenschaft Des Eisenbahngtertarifs - Die Akute Mittelohrentzndung - Der Schdelschuy - Grundriy Der Wildbachverbauung - Handbook Of Space Security - Serviceinnovationen In Industrieunternehmen Erfolgreich Umsetzen - Thoraxtumoren - Die Eigenschaften Elektrotechnischer Isoliermaterialien In Graphischen Darstellungen - Energy Transport And The Environment - Corporate E-learning - Advances In Digital Image Processing - Grundlagen Der Allgemeinen Und Speziellen Arzneiverordnung - Ein Haus In Europa - Prandtl - Hrer Durch Die Strmungslehre - Die Kommanditgesellschaft Auf Aktien Kgaa - Hygienisches Taschenbuch - Druck Und Stress Im Vertrieb Positiv Nutzen - Az Handbuch Asbestzementrohre - Operatorenrechnung - Junge Ostdeutsche Auf Der Suche Nach Der Freiheit - Coping And Self-concept In Adolescence - Circles Of Support - Parkinson Disease - Der Krieg Der Banken - B2c Elektronischer Handel Eine Inventur - Rechneruntersttztes Projektieren Und Konstruieren - Maschinenuntersuchungen - Mental Health Outcome Measures - Gesetz Ber Die Aufwertung Von Hypotheken Und Anderen Ansprchen Aufwertungsgesetz Vom 16 Juli 1925 Und Durchhrungsverordnung Vom 29 November 1925 - Konflikte Konstruktiv Bearbeiten Lernen - Ultraschall Wird Lesbar - Erfolgreiches It-management Im Ffentlichen Sektor - Beziehungen In Der Jugendarbeit - Die Geologischen Grundlagen Der Verbauung Der Geschiebeherde In Gewssern - Grundlagen Der Wahrscheinlichkeitsrechnung Und Statistik Sowie Anwendungen Im Operations Research - Due Diligence In Der Praxis - Lehrbuch Der Astronomie - Sehen Lernen In Der Fernsehgesellschaft - Die Grundlagen Der Einsteinschen Gravitationstheorie - Introduction To Nonlinear Thermomechanics - Algorithmics - Wirtschaftspolitik Und Regierungssystem Der Bundesrepublik Deutschland - Terroristische Diktaturen Im 20 Jahrhundert - Cardiac Adaptation In Heart Failure - Gaba Outside The Cns - Tops 09 - Die Versorung Der Familie - Nonlinear Analysis Of Physiological Data - Wahl Der Nahrungsproteinegrundlagen Und Ditetik - Innovatorenorientierte Akzeptanzforschung Bei Innovativen Medientechnologien - Mathe-manga Analysis - Immunopharmacology Reviews - –ffentlicher Personennahverkehr - Das Politische System Der Usa - The Pathology Of The Endocrine Pancreas In Diabetes - Modernes Personalmanagement - Berufsbiographien - Migration Aus Afrika In Die Eu - Der Coronarkreislauf - Grammatik Und Sprachverarbeitung - Psychopharmacogenetics - Industrieelektronik - Politik Und Regieren In Bayern - Transportvorgnge In Der Verfahrenstechnik - Numerische Verfahren Der Konvexen Nichtglatten Optimierung - Investition Finanzierung Und Besteuerung - Forschung Und Handeln - Aerodynamic Theory - Life Under Extreme Conditions - Der Das Unendliche Kannte - Hair Research - Handbuch Der Radium-biologie Und Therapie - Theoretische Atomphysik - Organisation Und Akzeptanz - Grundriss Der Hygiene - Kompendium Systembiologie - Countertrade Professionell - Optik Des Menschlichen Auges - Einhrung In Die Baustatik - Digitale Kommunikationsnetze - Nephrocalcinosis Calcium Antagonists And Kidney - Natur Wissenschaft Und Ganzheit - Water Analysis - Recent Developments In Micromechanics - Ddr-jugend - Die Wirklichkeit Der Medien - Functional Analysis And Economic Theory - Aufbau Betrieblicher Informationssysteme - Runder Tisch Und Direkte Demokratie - Immobilieninvestment In Den Usa - Die Frequenzkennlinien - Die Physiologische Entwicklung Des Kindes - Adaptive Wavelet-analysis - Phonosurgery - Die Gewerblichen Und Industriellen Abwsser - Beginning Android Adk With Arduino - Grundzge Der Technischen Wirtschafts- Verwaltungs- Und Verkehrslehre - Die Chemisch-technischen Untersuchungs-methoden Der Zellstoff- Und Papier-industrie - Interdisziplinre Risikoforschung - Love As Pedagogy - Einhrung In Die Kryptologie - Das Unternehmertum Und Die Ffentlichen Zustnde In Deutschland - Digital Business In Banken - Chemisorption Und Ionisation In Metall-metall-systemen - Entwurf Und Diagnose Komplexer Digitaler Systeme - Akkulturation Von Migrantinnen - Kasuistische Beitrge Zur Modernen Pharmakotherapie Mit Quetiapin - Direkte Demokratie In Den Deutschen Lndern - Stem Cells And Human Diseases - Erster Unterrieht Des Jungen Drogisten - Parteienwettbewerb Im Bundesstaat - Extra- Und Intrakranielle Farbduplexsonographie - Der Vernetzte Konsument - Politische Bildung In Deutschland - Die Politische Konstitution Von Mrkten - A Probabilistic Framework For Point-based Shape Modeling In Medical Image Analysis - Leistung Und Weg - Praktische Numerik Mit Mathematica - Methoden In Der Medizinischen Cytogenetik - Computer Games And New Media Cultures - Regionalisierung - Progressive Multiple Sclerosis - Mnnlichkeit Und Soziale Ordnung - Neue Jugendbiographie - Lebenserinnerungen Eines Ingenieurs - Die Verfahren Der Plastischen Berechnung Biegesteifer Stahlstabwerke - Starthilfe Thermodynamik - Erfolgsorientierte Gesprchshrung - Vorsorgendes Hochwassermanagement Im Wandel - Global Problems And Common Security - Die Vorbereitung Zu Chirurgischen Eingriffen - Windkraftanlagen Im Netzbetrieb - Kurze Anleitung Zur Appretur-analyse - Baukultur Wohnkultur –kologie - Digitalisfibel Den Arzt - Mathematische Algorithmen Im Unterricht - Die Trockentechnik - Beitrag Zur Theorie Und Untersuchung Der Ferrarismessgerte - Die Gewinnbeteiligung Der Arbeiter Und Angestellten In Deutschland - Soziale Arbeit Als Wissenschaft - Kritische Empirie - Wages Regime Switching And Cycles - Einhrungskurs Hhere Mathematik - Marketing Intelligence - Mathematik Ingenieure Und Naturwissenschaftler Band 2 - Medienethik Und Medienwirkungsforschung - Demokratie Und Demokratiemessung - Colour Atlas Of Tropical Dermatology And Venerology - Grundzge Der Eisenbahnwirtschaftslehre - Drucklufterkrankungen - Bauen Mit Din-normen - Klinik Und Therapie Der Herzkrankheiten Und Der Gefyerkrankungen - Krieg Als Medienereignis - Pfadfinden - Structure And Function In Normal And Abnormal Hips - Drehschwingungen In Kolbenmaschinenanlagen Und Das Gesetz Ihres Ausgleichs - Ethics In Reproductive Medicine - Enzymologie - Grundlagen Der Gasdynamik - Metallfachrechnen 5 Heizungs- Und Raumlufttechnik - Soziale Ungleichheit In Deutschland - Katalyse Und Determinismus - Soziologische Aufklrung 1-6 - Principles Of Turbomachinery - Mathematik Ingenieure - Lernort Universitt - Soziologielehre In Deutschland - Vaginalsonographie Im Ersten Schwangerschaftsdrittel - Taschenbuch Bauingenieure - Atlas Der Lokalansthesie - Die "wissensgesellschaft" - Prfungsvorbereitung It-berufe - Die Ordnung Der Freiheit - Die Wissenschaftlichen Grundlagen Der Nassen Erzaufbereitung - Marketing Lohas - The Pneumonias - Methoden Der Freizeitforschung - Antenatal Diagnosis Of Fetal Abnormalities - Massenmedien Und Lokaler Protest - Hilfsbuch Apotheker Zum Potenzieren Und Taxieren Homopathischer Und Biochemischer Arzneimittel - Carl Friedrich Gauss Werke - Rentabel Durch Total Quality Management - Psychotherapeutische Interaktion - Das Medien-klima - Die Electrische Beleuchtung - Betriebliche Soziale Arbeit - Zwischen Pragmatischer Und Moralischer Ordnung - Bildung Als Bedrohung - Chemische Funktionslehre - Information Systems Engineering - Handbuch Festkrperanalyse Mit Elektronen Ionen Und Rntgenstrahlen - Das Deutsche Beamtengesetz Dbg - Spinal Cord Stimulation Ii - Die Wechseljahre Der Frau - Wege Erwachsener In Die Welt Der Schrift - Computerdynamik Der Tragwerke - Psychiatriereformen Zwischen Medikalisierung Und Gemeindeorientierung - Topspeed Modula-2 Von Az - Simultaneous Engineering - World Population Policies - Unternehmen In Der Kologischen Diskussion - Imagewirkungen Von Eventmarketing - Natur Als Grundlage Und Ziel Der Wirtschaft - Elektro-fachkunde 2 - Die Landschaften Der Britischen Inseln - Einhrung In Die Gegekunde Der Geologischen Krper - Energiesparendes Bauen - Anticipative Criminal Investigation - Wirkung Nach Plan - Advances In Manufacturing Technology Ii - Imaging Of Gastrointestinal Tract Tumors - Grundzge Einer Soziologie Des Musikgeschmacks - Von Der Karitativen Sorge Zum Rztlichen Selektionsblick - Natural Products Chemistry Iii - Wahrscheinlichkeitsrechnung Und Statistik In Beispielen Und Aufgaben - Die Nachhaltigkeit Von Entwicklungsprojekten - Luhmann Modelliert - Jugend Privat - Chemical Structures - Nahost Jahrbuch 2000 - Digital Products - Jugend Vor Der Moderne - Managing Business Portfolios Effectively - Grundriss Der Gesundheitssorge - Paul Ehrlich - Recent Developments In Alcoholism - Entwurf Robuster Regelungen - Neuroblastoma - Rekonstruktion Von Vergangenheit - Stress Proteins - Parteien In Der Brgergesellschaft - Komplikationsmanagement Im Herzkatheterlabor - Grundfragen Des Mathematikunterrichts - Ursachen Saisonaler Holzpreisschwankungen - Einhrung In Die Soziologische Gesellschaftsanalyse - Kritische Differenzen Geteilte Perspektiven - Baustoffchemie - Klinische Epikrisen - Raum Zeit Materie - Psychologie Als Empirische Wissenschaft - Hilfsbuch Metalltechniker - Die Reichseisenbahnen - Kreativitt Und Form - Evaluation Von Programmen Und Projekten Eine Demokratische Kultur - Fachbegriffe Internationale Rechnungslegungglossary Of International Accounting Terms - Die Tumoren Der Pinealisregion - Pediatric Ultrasonography - Buchhrung Und Bilanzierung - Systems Theory And Biology - Junge Erwachsene In Europa - Vom Wohlfahrtsstaat Zum Wettbewerbsstaat - Internationale Whrungsprobleme - Das Kupferschweiyverfahren Insbesondere Bei Lokomotiv-feuerbchsen - Wenn Aus Liebe Rote Zahlen Werden - Lehrbuch Der Textilchemie - Ausschreibungshilfe Auyenanlagen Und Tiefbau - Montage Als Kunstform - Stochastik - Schul- Und Unterrichtsreform Durch Ergebnisorientierte Steuerung - Die Funktionsprfung Des Akustischen Und Statischen Labyrinths - Marken Erleben Im Digitalen Zeitalter - Ehrenamt Und Integration - Intensivmedizinische Praxis - Die Beratene Gesellschaft - Advances In Superconductivity Iv - Nachrichtenschreiben - Privatsache Kind Privatsache Beruf - Demokratie Und Judenbild - Partielle Differentialgleichungen - Konjunktur- Und Wachstumspolitik Konflikt Oder Konnex - Betriebs- Und Selbstkostenprobleme Der Wollindustrie - Geldanlage In Steueroasen - Unternehmensbewertung In Osteuropa - Erfolgreicher Unternehmensverkauf - Leichte Dampfantriebe An Land Zur See In Der Luft - Lehrbuch Der Zeitgemyen Vorkalkulation Im Maschinenbau - Kaiser Wilhelm 17971877 - Atlas Of Transesophageal Color Doppler Echocardiography And Intraoperative Imaging - Alterspsychotherapie Quo Vadis - Hochhuser In Deutschland - Rechnen An Spanenden Werkzeugmaschinen - Nfstellige Logarithmische Und Trigonometrische Tafeln - Schlagfertig Im Verkauf - Proactive Intelligence - Judith Butler Pdagogische Lektren - Introduction To The Fine Structure Of Plant Cells - Partnerwahl Im Internet - Lonely Children And Adolescents - Adnexal Tumors Of The Skin - Der Psychologische Test - Computer In Der Schule 3 - Meytechnik An Maschinen Und Anlagen - Pro Php Mvc - The Plant Plasma Membrane - Der Nahrungsmittelchemiker Als Sachverstndiger - Herrschaftstheorien Und Herrschaftsphnomene - New Aspects On Respiratory Failure - Thromboseprophylaxe Bei Ambulanten Patienten Mit Gipsimmobilisation - Advances In Fertility Control And The Treatment Of Sterility - Das Novellierte Gesetz œber Das Gerichtliche Verfahren Ausser Streitsachen Verlassenschaftsabhandlung Vormundschaft · Freiwillige Schtzung Und Feilbietung - Die Reichsdienststrafordnung Rdsto - Structured Document Image Analysis - Theoretische Konzepte Der Physik - Technik- Und Wissenschaftsethik - Thonner Analytical Key To The Families Of Flowering Plants - Der Unscharfe Ort Der Politik - Grundlegung Der Lehre Vom Sozialen Verband - Angewandte Gestalttheorie In Psychotherapie Und Psychohygiene - Dv-controlling Bei Finanzdienstleistern - Planung In Der Krise - Organizational Politics - Die Elektrische Beleuchtung Von Eisenbahnfahrzeugen - Die Brennstoffe - Technik Aus Soziologischer Perspektive - Sexology - Qualitative Perspektiven Des Medienwandels - Das Kriegsgeschehen 2001 - Fine Structure Immunocytochemistry - Das Fenster Zum Raum - Therapie Und Prvention Mit Kalziumantagonisten - The Dermal Lymphatic Capillaries - Konfrontative Pdagogik - Towards One-pass Synthesis - Variationsrechnung - Herzhypertrophie - Humankologie - Ontogeny Cell Differentiation And Structure Of Vascular Plants - Gabler Versicherungs Lexikon - Innovationsfhigkeit Durch Reflexivitt - Einhrung In Die Programmiersprache C++ - Elektrische Stoyfestigkeit - Edelrassen Des Waldes - Regional Acidification Models - Mensch Maschine Megabyte - Modellbildung Und Simulation - Mathematica In Der Theoretischen Physik - Technik Arbeit Betrieb Gesellschaft - Prostaglandins And The Uterus - Grundzge Der Pflanzenanatomie - Stadtumbau Unter Schrumpfungsbedingungen - Festband Zum 70 Geburtstag Von Rolf Nevanlinna - A Course In Mathematical Physics 3 - Der Herzanfall - Wrmetheorie - Geburtshilflich-gynkologische Propdeutik - The Systematic Identification Of Flavonoids - Synchronization Of Eeg Activity In Epilepsies - Was Determiniert Wortstellungsvariation - Der Euro-kapitalmarkt - Analysis Of Dynamic Psychological Systems - Ein Leben Ohne Kinder - Spannbeton - Materialtheorie - Einhrung In Die Spieltheorie - Die Entstehung Der Knotentheorie - Von Der Abfallwirtschaft Zur Kologischen Stoffwirtschaft - Ausbildungskompass Rechtsanwalts- Und Notarfachangestellte - „nicht So Wie Unsere Eltern! - Das Sokratische Gesprch In Theorie Und Praxis - Grundkurs Knstliche Intelligenz - Matlab For Psychologists - Berechnung Und Gestaltung Der Federn - Arzneipflanzenkultur Und Kruterhandel - Erwerbsarbeit Und Unterhaltswirtschaft - Geschlechterdemokratie - Organisationen Und Netzwerke Der Fall Gender - Paradigmen Der Bewegungsforschung - Immobilien Investment - Bahnhofsverzeichnis Zum Achsdruckverzeichnis - Physikalischen Und Chemischen Methoden Der Quantitativen Bestimmung Organischer Verbindungen - Gynkologische Operationen - Atomphysik - Asymptotics For Associated Random Variables - Industrial Production Models - Die Lehre Von Den Pupillenbewegungen - Das Journalistische Interview - Bibliographie Der Gesamten Gynaekologie Und Geburtshilfe Sowie Deren Grenzgebiete Das Jahr 1913 - 1632 Bit-mikroprozessorsysteme - Progress In Advanced Structural And Functional Materials Design - Denkmal Und Energie - Aus Dem Auen-mittelwalde - Pltzlicher Herztod - Zahlungsverhalten Am Stationren Point Of Sale - Quantum Mechanics On The Personal Computer - The Nuclear Shell Model - Handbuch Des Bankmarketing - Finanzierung Und Frderung Von Kinospielfilmen In Deutschland - The Subcommissural Organ - Das Europische Gleichgewicht Der Zukunft - Nanorobotics - Aushandlung Ohne Dissens - Gestaltung Und Management Von It-vertrgen - Die Bergwerksmaschinen Eine Sammlung Von Handbchern Betriebsbeamte - Dynamic Capabilities Als Einflussfaktoren Des Markteintrittstimings - Informierte Grndungsfrderung - Fuzzy-theorie Oder Die Faszination Des Vagen - Die Cdu Auf Landesebene - Theoretical Physics - Das Entscheidungssystem Der Europischen Union - Vernetzte Wirtschaft Und Konomische Entwicklung - Biokatalyse - Coronary Stents - Das 1 X 1 Des Wissenschaftlichen Arbeitens - Hrer Durch Die Technische Mechanik - Verdichtung Weltverlust Und Zeitdruck - Die Grundlagen Zur Besserung Der Stdtischen Wohnverhltnisse - Rollenkonfigurationen Rollenfunktionen Und Gesundheit - Der Neue Mobile-commerce - Kommentar Atv Din 18 350 Und Din 18 299 - Emergencies In General Practice - Software Engineering Economics And Declining Budgets - Der Landwirtschaftliche Kredit Und Seine Durchgreifende Verbesserung - Differential- Und Integralrechnung - Biogeography And Taxonomy Of Honeybees - Politische Diskurskulturen In Europa - Lehrbuch Der Gesamten Chemie - Anleitung Zur Beurteilung Und Bewertung Der Wichtigsten Neueren Arzneimittel - Entstehung Und Entwicklung Des Rechtsextremismus In Der Bundesrepublik - Komplexittsmanagement - Das Phnix-phnomen - Technique Of Internal Fixation Of Fractures - Spaltungen Der Gesellschaft Und Die Zukunft Des Sozialstaates - Wirtschaftspolitik Kompakt - Kesselbetrieb - Moderne Mythen Der Medizin - Die Knstliche Seide - The Political Economy Of Progressive Taxation - Die Methode Der Festpunkte - Menschenkenntnis Hrungskrfte - Die Berechnung Elektrischer Anlagen Auf Wirtschaftlichen Grundlagen - Die Septischen Erkrankungen In Der Inneren Medizin - Daily Soaps Und Daily Talks Im Alltag Von Jugendlichen - Hochschulreform In Europa Konkret - Source Book Of Flavors - Das Konstrukt „bevlkerung Vor Im Und Nach Dem „dritten Reich - Nahost Jahrbuch 2004 - Pfadintegrale In Der Quantenphysik - Coronary Circulation - Statik Der Stabtragwerke - Die Politik Der Infosphre - Hausfamilien - Hhere Mathematik Mit Mathematica - Stammesgeschichte Der Sugetiere - Transformationen Und Signale - Enzymkatalyse - Deutsche Politikwissenschaftler In Der Emigration - Kompendium Internistische Onkologie - Aufgabensammlung Elektrotechnik 1 - Genital Papillomavirus Infections - Die Ethnisierung Von Alltagskonflikten - Tissue Characterization In Mr Imaging - Isdn Und Lokale Netze - Die Organismusidee In Mllers Dauerwaldgedanken - Druckstollenbau - Die Pflanzenalkaloide - Demographische Analyse Und Populationsdynamische Modelle - Handbuch Medienwirkungsforschung - Fermentation - Haushalt-kltemaschinen Und Kleingewerbliche Khlanlagen - Kindheitsforschung Und Kommunale Praxis - Pro Html5 Accessibility - Viruskrankheiten Des Menschen - Allgemeine Pathologie - Rollenmodelle Der Hrung - Doppelte Buchhrung - The Paraneuron - Wieviel Demokratie Vertrgt Europa Wieviel Europa Vertrgt Die Demokratie - Rassismus Wider Willen - Gewinne Einkaufen - Single-photon-emissions-computertomographie Spect Des Gehirns - Regionale Modernisierungspolitik - Marketingstrategien Rezeptfreie Arzneimittel - Soziale Netzwerke In Unternehmen - Urate Deposition In Man And Its Clinical Consequences - Sustainability In Tourism - Technologie Wachstum Und Beschftigung - Orthopdischrheumatologische Kurmedizin - Einhrung In Die Methoden Der Empirischen Soziologie - Sehnenverletzungen Und Sehnen-muskeltransplantationen - Programmieren Spielend Gelernt Mit Dem Java-hamster-modell - Zur Organisation Des Grndungserfolgs - Frauen Und Medien - Vorfuychirurgie - Betriebliche Kinderbetreuung Von 1875 Bis Heute - Algebra Aller Anfang Ist Leicht - Handbuch Militrische Berufsethik - Unternehmen Auf Neuem Kurs - Pflegebedrftigkeit Und Pflegesicherung In Ausgewhlten Lndern - Plasmids - Nicht-numerische Informationsverarbeitung - Energierecht - Eingebettete Systeme - Sachsen-anhalt - Arbeiten Mit Kunststoffen - The Biology Of Subcellular Nitric Oxide - Biometrie - Europisches Steuerrecht - Das Panaritium - Singles - Generation Transformation - Transnationale Konzerne Im Weltsystem - Unternehmen Unix - Brgerliches Recht 2 - Fluid- Und Wrmetransport Wrmebertragung - Die Wiederentdeckung Der Diaspora - Bildgebende Diagnostik Bei Lebererkrankungen - Der Aufbau Der Materie - Human-computer Interaction - Delphi Essentials - Advances In Molten Salt Chemistry - Grundlagen Der Psychologischen Diagnostik - Berufsausbildung In Der Ddr - Allgemeine Algebra Und Anwendungen - Ion Channels - Opportunities And Constraints Of Parallel Computing - Einhrung In Den Wrme- Und Stoffaustausch - Der Bankbetrieb - Die Bodenmechanik In Der Baupraxis - Grenzobjekte - Wohlfahrtsstaatliche Politik - Dekonstruktive Pdagogik - Eine Verfassung Die Europische Union - Arbeit Und Subjektwerdung In Der Moderne - Gesundheitskommunikation - Gemischt-ganzzahlige Optimierung Modellierung In Der Praxis - Jugend Joystick Musicbox - Cim-handbuch - Voices From The Classroom - Forschungsmanagement Steuerungsversuche Zwischen Scylla Und Charybdis - Nierentransplantation - Lebensstile Durch Werbung - Observations Concerning The Planet Venus - Praktische Betriebslehre - Seminar - Symptomorientierte Diagnostik Bei Aphasien - Praktische Informatik - Eine Einhrung - Kindheit Soziologisch - Wege Aus Der Ausbildungskrise - Asl Portable Programmierung Massiv Paralleler Rechner - Arterial Variations In Man - Die Medikamentse Und Allgemeine Behandlung Der Ohrenkrankheiten - Politik Medien Technik - „lter Werdende Und Ltere Frauen Heute - Konferenzen Professionell Organisieren - Acht Jugendportrts - Telearbeit - Ernst Mach - Geschlecht Und Geschlechterverhltnisse In Der Erziehungswissenschaft - Das Politische System Ungarns - Die Wrmewirtschaft In Der Zellstoff- Und Papierindustrie - Intellektuelles Kapital Und Wettbewerbsfhigkeit - Lebensmittelmikrobiologie - Handbuch Pdagogische Anthropologie - Ist Die Brse Reformbedrftig - Prostatitis - Dokumentation In Der Mess- Und Prftechnik - Die Dritte Generation Der „roten Armee Fraktion - Information Processing In The Nervous System - Soziale Arbeit Und Medien - Krankheiten Der Verdauungsorgane - Pdiatrische Gynkologie - Der Mensch Und Die Zeit - Geschichte Der Csu - Mathematical Physics X - Die Geschichtliche Methode In Der Forstwirtschaft - Klinische Rntgendiagnostik Des Verdauungskanals - Physikalisch-chemisches Rechnen - Kompendium Der Balneologie Und Kurortmedizin - Lehrbuch Der Geisteskrankheiten - Kochlehrbuch Und Praktisches Kochbuch - Modern Food Analysis - Das Wrmetechnische Meywesen In Dampfkraftwerken Und Industriebetrieben - Klinik Der Lungentuberkulose - Die Technische Mechanik Des Maschineningenieurs Mit Besonderer Bercksichtigung Der Anwendungen - Kundengesprche Souvern Meistern - Vieweg Taschenlexikon Technik - Holz- Und Baumpilze - Werbepdagogik In Der Grundschule - Formeln Und Tabellen Elektrotechnik - Eisenbahnanlagen Und Fahrdynamik - Salben · Puder · Externa - Afrika Jahrbuch 1995 - Kommunikationsverhalten Und Geschlecht - Experimentelle Forschungen Ber Bleiaufnahme Und Bleiausscheidung Und Ihre Bedeutung Gewerbehygiene Und –ffentliche Gesundheit Unter Besonderer Bercksichtigung Von Bleitetrathyl Und Bleihaltigen Kraftstoffen - Cordless Telecommunications In Europe - Die Chronisch Erhht Gefhrlichen - Wind Energy - Differentialgeometrie Und Homogene Rume - Heterocyclic Chemistry - Angiographie Der Hand - Gewerkschaften In Der Japanischen Politik Von 1970 Bis 1990 - Benchmarking - Das Schmerzproblem Und Seine Forensische Bedeutung - Journalismus Als Soziales System - Die Wirtschaftliche Erzeugung Der Elektrischen Spitzenkraft In Groystdten - Lebensmitteltoxikologie - Brgermeister Curtius - An Introduction To Theoretical Geomorphology - Magnetic Reconnection - Die Gichtgas-reinigung - Supercomputing - Social Media Balanced Scorecard - Pro Windows Embedded Compact 7 - Lehrerinnen In System Und Lebenswelt - Metallurgische Berechnungen - Das Wasser Seine Verwendung Reinigung Und Beurtheilung Mit Besonderer Bercksichtigung Der Gewerblichen Abwsser Und Der Fussverunreinigung - Ambivalente Gesellschaftlichkeit - Betriebssttten In Russland - Sinnwelt Freizeit - Zweckrationalitt Und Strafrecht - The Perfect Test - Rohrleitungen - Frauen Im Militr - Lehrbuch Der Diagnostischen Und Operativen Cystoskopie - Benign Lesions Of The Esophagus And Cancer - Neurologie Des Vegetativen Systems - Geschichte Der Politischen Bildung In Der Bundesrepublik Deutschland 1945 198990 - Umwelt Und –konomie - Berechenbarkeit Komplexitt Logik - Das Versuchswesen Auf Dem Gebiete Der Pflanzenphysiologie Mit Bezug Auf Die Landwirthschaft - Management Der Wertschpfungsketten In Banken - Fortschrittliche Lagerung Und Behandlung Schwerverwundeter - Kurzes Handbuch Der Ophthalmologie - Entwicklungs-geschichte Der Augenrztlichen Kunst-ausdrcke - Satellitenortung Und Navigation - Die Elektrische Kraftbertragung - Das Kleine Nein Im Groyen Ja - Elektrodynamik - Politikwissenschaftliche Spiegelungen - Der Gynkologische Operationskursus - Akzeptanz - Medienpdagogik In Der Kommunikationswissenschaft - Kreditrisikotransfer - Eine Einhrung In Jugendkulturen - Innere Medizin - Heterogene Katalyse Ii - Der Verband - Steuerungstechnik Maschinenbauer - Optimierungsmethoden Des Operations Research - Innovation Macht Schule - Caspar Neher Der Gryte Bhnenbauer Unserer Zeit - Physik Und Technik Der Atomreaktoren - Die Hohe Schule Des Total Quality Management - Differenz Und Integration Die Zukunft Moderner Gesellschaften - Sozialismus Und Nation - Acoustics Of Solids - Schriftlichkeit Und Gesellschaft - Integriertes Content Management In Fernsehunternehmen - Aktuelle Aspekte Medienpdagogischer Forschung - Akquisition Auftrag Profit - Baumwollspinnerei - Atlas Of Bone Scintigraphy In The Developing Paediatric Skeleton - Moralische Individualitt - Wiederkehr Des „volksgeistes - Bevlkerungswissenschaft Quo Vadis - Berufsbiografie Und Familiengrndung - Stadtregion Und Wissen - High-performance Scientific Computing - Online-medien Als Quellen Politischer Information - Anfangsgrnde Der Chemie - Aufgaben Politischer Bildung In Der Sekundarstufe I - Gewhnliche Und Operator-differentialgleichungen - Website Marketing - –kologische Risiken Im Kreditgeschft - Medienregulierung Durch Die Gesellschaft - œbungsbuch Strmungsmechanik - Running Ipv6 - Bewegungs- Und Krperorientierte Anstze In Der Sozialen Arbeit - Die Behandlung Der Quartren Syphilis Mit Akuten Infektionen - Breast Diseases - Einhrung In Die Erziehungswissenschaft - Farbatlas Der Histologie Der Regenbogenforelle - Kriegsschiffbau - European Perspectives On Taiwan - Surgical Anatomy And Technique - Annherung An Die Volkspartei - Marken-power - Stochastic Structural Dynamics 2 - Modern Trends In Virology - Synthetic Aspects Of Aminodeoxy Sugars Of Antibiotics - Immobilien-management - Die Elektronenrhre Als Physikalisches Meygert - Lndliche Netzwerke - Windows Phone Application Sketch Book - Privatheit Garten Und Politische Kultur - Mri Of The Body - Surgery Of The Sellar Region And Paranasal Sinuses - Technological Change In A Spatial Context - Fernsehen Und Hrfunk Die Demokratie - Die Anatomie Des Menschen - Literatur In Der Funktional Differenzierten Gesellschaft - Naturwissenschaftliche Bildung In Deutschland - Lsungen Mandantenorientierte Sachbearbeitung - Scherzkommunikation - Die Infektion Beim Brandverletzten - Export Consortia In Developing Countries - Die Private Vermgensanlage Des Unternehmers - Regionale Akteursnetzwerke - Die Pflanzenzucht Im Walde - Weltordnungspolitik - Versicherungswirtschaftslehre - Die Soziologen Und Das Recht - Familienerziehung Im Historischen Wandel - Staat Und Glck - Bundestagswahl 2002 - Das Verbrechen I - Schulpolitik Und Schulsystem In Der Ddr - Lebenslagen Im Strukturwandel Des Alters - Der „hugenberg-konzern - Medien Und Sthetische Kultur - Bildung Arbeit Erwachsenwerden - Controversy In Cardiology - Einhrung In Das Marketing - Familie Und Staatliches Handeln - Allgemeine Und Spezielle Chirurgische Operationslehre - Huser - Linguistic Identity Matching - Cfd Handel - Verwaltungscontrolling - Eliten Macht Und Konflikt In Der Bundesrepublik - Die Arzneimittel-synthese Auf Grundlage Der Beziehungen Zwischen Chemischem Aufbau Und Wirkung - Einhrung In Die Technische Schwingungslehre - Tricad Ms - Erfahrungen Mit Schiffsdieselmotoren - Handbook Of Biological Confocal Microscopy - Gabler Lexikon Recht In Der Wirtschaft - Bildlexikon Der Dermatologie - Zwischen Anpassung Und Konfrontation - Beginning Windows Phone App Development - Sozialisation In Den 90er Jahren - Stoffaufnahme · Stoffwanderung Wachstum Und Bewegungen - Wrmebertragung Im Gegenstrom Gleichstrom Und Kreuzstrom - Griechische Sakralaltertmer Hhere Lehranstalten Und Den Selbstunterricht - Handbuch Der Gieyerei-technik - Ermdungsrisse - Neue Anstze Im Kulturmanagement - Datenbank-engineering Wirtschaftsinformatiker - New Macromolecular Architecture And Functions - Der Berzeugende Persnliche Auftritt - Die Stationre Psychotherapie Und Ihr Rahmen - Unternehmen Berlebensfhig Machen - Contested Public Spheres - Besondere Osteosynthesetechniken - Messen Im Wandel - Kreditpolitik - Migration Zu Windows 2000 - Regionalisierung Der Strukturpolitik In Nordrhein-westfalen - Berechnung Von Gleichstrom-kraftbertragungen - Total Quality Management As A Holistic Management Concept - Teubner-taschenbuch Der Stochastik - Konsensus Und Interessen - Beginning Android 4 - Meningitis Im Kindesalter Und Neugeborenensepsis - Fachwerk Und Rahmenwerk - Glck Und Zufriedenheit - Quantitative Methoden Der Organisationsforschung - Forstliches Rechnen - Sprechwissenschaft And Psycholinguistik - Wasserversorgung - Handlungsproblem Computer - Erfolgreich Gegen Kopfschmerzen Und Migrne - Die Praxis Der Zahnextraktion Einfchlieylich Der Rtlichen Schmerzbetubung - Die Dampfkessel Und Ihr Betrieb - Der Sozialrumliche Blick Der Jugendarbeit - Neonatal Heart Disease - The Decade Of Medicine Or The Physician Of The Rich And The Poor - Modalitt Im Deutschen - Chinas Lndliche Gesellschaft Im Umbruch - Demokratie In Deutschland - Fachbezogene Informationsverarbeitung - Excel Fortgeschrittene Am Beispiel Der Darlehenskalkulation Und Investitionsrechnung - Standards In Pancreatic Surgery - Grundriss Einer Meteorobiologie Des Menschen - Pro Multithreading And Memory Management For Ios And Os X - Drugs Neurotransmitters And Behavior - Raumdekonstruktionen - Primary And Secondary Metabolism Of Plant Cell Cultures Ii - Ergebnisse Der Chirurgie Und Orthopdie - Das Bestseller-phnomen - Operationslehre Der Endoskopischen Chirurgie 1 - Politik Und Verwaltung Nach Der Jahrtausendwende Pldoyer Eine Rationale Politik - Knig Brgermeister Bundeskanzler - Festverzinsliche Wertpapiere - Handbuch Der Deutschen Arzneipflanzen - Handbuch Politische Partizipation Von Frauen In Europa - Bakteriologische Grundlagen Der Chemotherapeutischen Laboratoriumspraxis - Dynamics Of Science-based Innovation - Die Lehre Von Der Zusammengesetzten Festigkeit Nebst Aufgaben Aus Dem Gebiete Des Maschinenbaues Und Der Baukonstruktion - Welfare Economics And Social Choice Theory - Towards A New Map Of Automobile Manufacturing In Europe - Masse Macht Emotionen - Nachhaltige Wasserbewirtschaftung - Die Chirurgische Behandlung Der Lungentuberkulose - Die „rztliche Beurteilung Beschdigter - Funkkolleg Altern 2 - Revision Des Grundgesetzes - Mathematik Bauingenieure - Java It-berufe - Die Krankheiten Des Herzens Und Der Gefsse - Thermodynamics For Chemists Physicists And Engineers - Genetic Constraints On Adaptive Evolution - Diagnostic Evaluation Of The Knee - Intraoperative Neurophysiologic Monitoring In Neurosurgery - Anatomie Und Physiologie Der Holzpflanzen - Fokussiertes Business Design - Die Elektrischen Wechselstrme - Energiewirtschaft - Landslides And Their Stabilization - Abdominal Angiography - œberblicke Mathematik 199697 - 100 Minuten Konfigurationsmanagement - Systemwechsel 4 - Die Kalkulation Im Schmiedegewerbe - Die Vlker Der Ehemaligen Sowjetunion - Max Webers Grundbegriffe - Hydergine - Maschinenbau Elektrotechniker - Molecular Electronics - Tropical Trees And Forests - Viele Welten - Grundkurs Regelungstechnik - Cryotechniques In Biological Electron Microscopy - Regionalkonomie - „rzte Oder Wunderheiler - Die Kunst Keine Perfekte Hrungskraft Zu Sein - Demokratie Und Verein - Karriere Machen Der Weg In Die Unternehmensberatung - Spontaneous Abortion - Differential Games - Die „tiologie Der Bsartigen Geschwlste - Code-wechsel - Herausforderung Terrorismus - Krankenpflege-lehrbuch - Elastische Platten - Current Topics In Biomedical Research - Die Architekturen Der Menschlichen Knochenspongiosa - Color Atlas Of Surgical Anatomy For Esophageal Cancer - Zehnkampf-power Manager - Verstehen Und Kritik - Critical Perspectives On Neoliberal Globalization Development And Education In Africa And Asia - Europapolitik Der Deutschen Lnder - Arbeitsvermgen - Practical Approaches To Alcoholism Psychotherapy - Der Dauerwald - Globalisierung Stadtrume Und Lebensstile - Gabler Lexikon Werbung - Handbuch Klebtechnik 20102011 - Clinical Applications Of Cardiac Ct - Die Mitte - Die Analyse Sozialer Ungleichheit - Geochemistry Of Sedimentary Ore Deposits - Die Raumbeziehungen Im Wirtschaften Der Welt - Quantum Electrodynamics - Anomalien In Handlungs- Und Entscheidungstheorien - A History Of The Royal College Of General Practitioners - Doomed To Internationalization And Modernization Of Corporate Culture - Agrar-–ko-audit - Acute Peripheral Vascular Surgery - Low Temperature Detectors For Neutrinos And Dark Matter - Mobilitt Von Jugendlichen - Gesundheitsbchlein - Distributionslogistik - Informations- Und Wissensverarbeitung In Den Sozialwissenschaften - Die Dampfkessel - Politische Kommunikation In Der Demokratischen Gesellschaft - Die Gasbehandlung Bsartiger Geschwlste - Leadership Branding - Grenzen Des Sozialraums - Klinische Arterienpulsschreibung - Acta Historiae Neerlandicaestudies On The History Of The Netherlands Vi - Interkulturelle Handlungskompetenz - Handbuch Der Polizeien Deutschlands - Green Business Process Management - Advanced Combustion Science - Rundfunkkonomie - Novel Calcium-binding Proteins - Solar Energy Conversion - Bewehren Nach Din En 1992-1-1 Ec2 - Einhrung In Die Festigkeitslehre - Bauen Im Bergbaugebiet - Atlas Of Muscle Innervation Zones - Das Wissen Bankkaufleute - Qualitt In Der Medizin Dynamisch Denken - Erfolgsfaktor Unternehmenskultur - Die Zoologie Der Trume - Aufbereitung Metallischer Sekundrrohstoffe - Particle Physics And Astrophysics Current Viewpoints - Die Quarzlampe - Ein Lehrbuch Der Botanik - Die Prfung Und Die Eigenschaften Der Kalksandsteine - Processed Meats - Armut Und Kindheit - Litigation-pr Alles Was Recht Ist - Profis Im Finanzvertrieb - Bauten Aus Beton- Und Stahlbeton-fertigteilen - Null Zoff And Voll Busy - Wahrscheinlichkeitsrechnung Und Stochastische Prozesse - Datenbertragung Technik Der Daten- Und Textkommunikation - Psychodynamik Und Psychotherapie „lterer - Kommutatorkaskaden Und Phasenschieber - Qualitt Im Theater - Druck Von Textilien - Die Digitale Kluft - Hhere Mathematik Studierende Der Chemie Und Physik Und Verwandter Wissensgebiete - Kritische Kriminologie In Der Diskussion - Der Betonpfahl In Theorie Und Praxis - Konkurrierende Generationen Auf Dem Arbeitsmarkt - Altersvorsorge Am Scheideweg - Handbuch Soziale Arbeit Und Alter - Die „vergessenen Frauen Aus Der Zuwanderergeneration - Freiheitsverlust Und Freiheitsentziehung - Glubigerstrategien Im Schuldnerkonkurs - Demokratiequalitt In –sterreich - Technology Cad Systems - Spannungsfeld Personalentwicklung - Wir Haben Uns Als Deutsche Gehlt - Allgemeine Chirurgie - Demographie Und Wohlstand - Transurethral Surgery - Michel Foucault Pdagogische Lektren - Die Virtuelle Gesellschaft Des 21 Jahrhunderts - Wortgefecht Und Sprachverwirrung - Myelin Repair And Neuroprotection In Multiple Sclerosis - Einhrung In Die Klassische Elektrodynamik - Gestational Diabetes - Die Festigkeit Von Druckstben Aus Stahl - Todesfuge - Interkulturelle Pdagogik Und Sprachliche Bildung - Lehrbuch Der Pharmakognosie - Quantum Fields Algebras Processes - Die Stereoskopie - Verfassungspolitik Und Verfassungswandel - Selbstwertmanagement - Organisation Und Steuerung Dezentraler Unternehmenseinheiten - Der Zahnlose Unterkiefer - Atmung Aufnahme Und Abgabe Gasfrmiger Stoffe - Landwirtinnen - Ertragstafeln Reine Und Gleichartige Hochmaldbeftnde Von Eiche Buche Tanne Fichte Kiefer Grner Douglafie Und Lrche - Beyond Elder Law - Spitzenkandidaten Und Wahlerfolg - Fluidik - Mathematik In Der Praxis - Warum Ausgerechnet Net - Social Dilemmas And Cooperation - Grundriss Der Rntgentherapie - Atlas Of Mammography - Soziologische Gegenwartsdiagnosen Ii - Lineare Algebra Und Analytische Geometrie Ii - Jugend-gewalt - Regelung Der Kraftmaschinen - Autologous Resurfacing And Fracture Dowelling - Partnerschaftskarrieren - Tropische Hochgebirgspflanzen - Hypercard Griffbereit - The Fractal Company - Beginning Ios 5 Development - Drogenkonsum Und -kontrolle - Aufbruch In Ein Gemeinsames Altern - Dermatosurgery - Software Development And Reality Construction - Anleger An Die Brse - Organic Acids In Geological Processes - Lehrbuch Der Histologie Und Der Mikroskopischen Anatomie Des Menschen - Sportmedizinische Forschung - Lehrbuch Der Konstruktiven Geometrie - Vertrauenskrise - Wealth Manager Was Nun - Kreativitt Und Krankheit - Weltpolitik Im 21 Jahrhundert - Wundinfektionen In Der Gefychirurgie - Das Patellofemoralgelenk Beim Knstlichen Kniegelenkersatz - Value Reporting - Erzhlen In Der Therapie - Die Halbierte Gesellschaft Der Postmoderne - Grundzge Des Eisenhttenwesens - Blockade Und Chirurgie Des Sympathicus - Eeg-œberwachung Des Intensivpatienten - Service Experience Value - Wirtschaftswrterbuch Dictionnaire ‰conomique - Medien-mythos - Betriebliche Informationskonzepte - Viruses Of Lower Vertebrates - Massenkommunikation - Baukosten Bei Neu- Und Umbauten - Den Kundennutzen Managen - Beobachten Und Nachdenken - Lernort Kinderfreunde - Bildungsbericht Deutschland - Рост Кристаллоь Rost Kristallov Growth Of Crystals - Robotersysteme 2 - Das Chaos Managen - Grundlagen Der Reprsentativen Statistik - Gutachten Des Reichs-gesundheitsrates Betreffend Die Verunreinigung Der Orla Und Ktschau Durch Gewerbliche Abwsser - Size-structured Populations - Hydrocarbons Of Eastern Central Europe - Reformen Jetzt! - Die Psychoanalyse Und Ihre Kinder - Die Arbeiterfrage - Armut In Der Stadt - Perception And Motor Control In Birds - Lehrbuch Der Toxikologie Studium Und Praxis - Kredite Aktiv Verkaufen - Analysis With Supercritical Fluids Extraction And Chromatography - The Role Of Community-mindedness In The Self-regulation Of Drug Cultures - Lehrbuch Der Kriegschirurgie - Plastic Surgery Of Head And Neck - Stadt Im Umbruch Gotha - Rekonstruktiv-responsive Evaluation In Der Praxis - Public Marketing - Regimes In Southeast Asia - Der Deutsche Olympische Sportbund In Der Zivilgesellschaft - Die Hauptprobleme Der Modernen Astronomie - Elektrische Messung Mechanischer Gryen - Analytische Berechnung Elektrischer Leitungen - Werkstoffe Gleitlager - Paare Im Wandel - Hefe Und Alkohol Sowie Andere Grungsprodukte - Die Zukunft Kommt Wohin Geht Die Wirtschaft - Aus Der Chirurgischen Praxis - Gewalt Als Soziales Problem In Schulen - Wert- Und Bedrfnisorientierte Segmentierung Von Konsumgtermrkten - Keine Probleme Mit Inversen Problemen - Entstehung Und Rckgang Des Landwirtschaftlichen Groybetriebes In England - Differentialdiagnose In Der Inneren Medizin - Die Berechnung Des Selbstkostenpreises Der Gewebe - Demokratie Lernen Im Alltag - Precancerous Conditions And Lesions Of The Stomach - Reconsidering Archaeological Fieldwork - Von Lichtgestalten Und Dunkelmnnern - Like It Lead It Change It Hrung Im Vernderungsprozess - Journalismus Und Wandel - Leime Und Kontaktkleber - Das Messen Mit Elektrischen Gerten - Grenzberschreitungen - Theories Of Fluids With Microstructure - Theorie Praktischer Probleme - Frhwarnindikatoren Und Krisenfrhaufklrung - Julius Springer - Pathologie Des Trauma - Einhrung In Die Technische Strmungslehre - Die Vorbereitung Des Hochofenmllers - Die Digitale Revolution - Spannweite Der Gedanken - Wahlkampf Um Das Weiye Haus - Interfaces Und Datennetze - Vergleichende Politikwissenschaftliche Methoden - Ungleichheit Soziale Beziehungen Und Gesundheit - Talsperren In Deutschland - Technologie Der Textilfasern - Die Nordwestdeutsche Heide In Forstlicher Beziehung - Ganztgige Bildung Und Betreuung Im Primarschulalter - Die Gewerkschaften In Politik Und Gesellschaft Der Bundesrepublik Deutschland - Die Mikroskopischen Boden-pilze - Kurze Geschichte Der Chirurgie - Die Ohnmacht Bei Der Geburt Vom Gerichtsrztlichen Standpunkt - Rheumatoid Arthritis - Marine Geochemistry - Internationale Professionalitt - Lexikon Der Soziologischen Werke - Politische Bildung Von 14-jhrigen In Deutschland - Fast Numerical Methods For Mixed-integer Nonlinear Model-predictive Control - Konstruktive Geometrie In Der Technik - Historische Frauen - Mechanische Verfahrenstechnik - Diphtherie Und Anginen - Laser In Forschung Und Technik Laser In Research And Engineering - Klausurtraining Hydrochemische Berechnungen - Organ Replacement Therapy Ethics Justice Commerce - Wertorientierung Und Zweckrationalitt - Das Knigliche Materialprfungsamt Der Technischen Hochschule Berlin Auf Dem Gelnde Der Domne Dahlem Beim Bahnhof Gross-lichterfelde West - Beitrge Zur Angewandten Wirtschaftsforschung - Metaphern Der ‚kur‘ - Schreiben Ohne Text - Operative Gynkologie - Die Mercerisation Der Baumwolle Mit Specieller Bercksichtigung Der In- Und Auslndischen Patente - Perugia Consensus Conference On Antiemetic Therapy - Exergie - Die Oxydativen Grungen - Rechtsradikale Gewalt Im Vereinigten Deutschland - Schreiben In Werbung Pr Und Journalismus - Raumforderungen Der Niere Im Sonographischen Bild - Rntgenatlas Zur Frhdiagnostik Des Bronchuscarcinom - Bone Circulation And Bone Necrosis - Einhrung In Die Rechtssoziologie - Die Hysterie - Organisationskommunikation Und Public Relations - On The Movement Of Animals - Gestalttheorie Und Psychotherapie - Jucs The Journal Of Universal Computer Science - Die Vorkalkulation Im Kessel- Und Apparatebau - Die Produktion Zentraler Ffentlicher Rume In Der Aufmerksamkeitskonomie - Ada - Kind Und Wohnen - Mathematik Neu Denken - Die Neurologisch-neurochirurgische Frhrehabilitation - Animal Lectins Form Function And Clinical Applications - Die Us-amerikanische Somaliaintervention 1992-1994 - Der Petroleum-ingenieur - Umweltpolitik In Ost- Und Westeuropa - Practice Questions In Psychopharmacology - Rheumaorthopdie Untere Extremitt - Qualitative Chemische Analyse - Philosophia Perennis - Baustoffe Tragende Bauteile - Die Versorgung Des Brandverletzten Im Katastrophenfall Band 2 - Adolescent Gynecology - Olfaction And Taste Xi - Gabler Banklexikon - Gewerbliche Vergiftungen - Stahlbau - Der Entzndungsbegriff - Ii Chemischer Teil - Mathematikunterricht In Der Sekundarstufe Ii - Cholecystokinin Antagonists In Gastroenterology - [email protected] - Stochastic Structural Dynamics 1 - Principles Of Bone Regeneration - Fehler Und Fehlerkultur Im Krankenhaus - Wie Aus Ideen Bilder Werden - Klassiker Des Managements - Umbruch In Ostdeutschland - Glass Chemistry - Chemistry And Biology Of Solid Waste - Das Zwiespltige Individuum - Internalisierung Und Strukturbildung - Kommunikation –ffentlichkeit –ffentlichkeitsarbeit - Die Rechtskunde Des Ingenieurs - Hilfsbuch Nahrungsmittelchemiker Zum Gebrauch Im Laboratorium Die Arbeiten Der Nahrungsmittelkontrolle Gerichtlichen Chemie Und Anderen Zweige Der Ffentlichen Chemie - Literatur Als System - Konfliktlotsen In Dienstleistungsunternehmen - Physics At Kaon - Innovationen Im Mittelstand Erfolgreich Managen - Depressive Illness - Alkohol Und Volksgemeinschaft - Zwischen Routine Ratsprsidentschaft Und Gipfel - Morphometry Of The Human Lung - Student Participation In Online Discussions - Seafood Proteins - The Machine As Metaphor And Tool - Jenseits Des Rationalen Handelns - Das Sprengluftverfahren - Psychologie Der Lebensalter - Caddy Grundkurs - Die Entwicklung Des Brandenburgisch-preussischen Apothekenwesens Bis Zum Erlass Der Revidierten Apothekerordnung Vom 11 Oktober 1801 - Regionale Governance Des Funktionswandels Von Flughfen - Die Technik Des Bankbetriebes - Desintegrationsdynamiken - Metallfachkunde 1 - Aneignung Und Interkulturelle Reprsentation - Tensor Analysis And Continuum Mechanics - Simulation By Bondgraphs - Struktur Entwicklung Und Frderung Von Lesekompetenz - Netzleittechnik - Kugelpackungen Von Kepler Bis Heute - Markenmanagement In Der Motorradindustrie - Klinische Physiologie - Virtuelle Gruppen - Heart And Brain Brain And Heart - Improving Soil Fertility Recommendations In Africa Using The Decision Support System For Agrotechnology Transfer Dssat - Late Reconstructions Of Injured Ligaments Of The Knee - Alternierende Telearbeit - –ffentlichkeit Und Vertraulichkeit - Nahost Jahrbuch 1988 - Wahlkampf In Den Medien Wahlkampf Mit Den Medien - Architektur Mit Dem Computer - Der Theoretische Wrmeverbrauch Einer Rohzuckerfabrik Verdampfen Erwrmen Verkochen Und Krafterzeugung - Recent Developments In Applied Demand Analysis - Solidaritt Lebensformen Und Regionale Entwicklung - Demokratie Und Streitkrfte - How Institutions Change - Mittel- Und Langfristige Exportfinanzierung - Handbuch Spannungs Messpraxis - Biogene Arzneistoffe - Sedimentary Basins - Dickwerden Und Schlankbleiben - Renal Cell Carcinoma - Zuknftige Entwicklungen In Der Mobilitt - Das Kraftfahrzeug - Endoscopic Retrograde Pancreaticocholangiography Erpc - Customer Integration - Schulterblick Und Stckelschuh - Herz Und Kreislauf - Streetball - Die Erkrankungen Der Schilddrse - Elektrische Reaktions-audiometrie - Taking Your Ipod Touch To The Max Ios 5 Edition - Die Entstehung Des Neuen In Der Adoleszenz - Magnetic Resonance In Nephrourology - Trafficking In Women In The European Union - Das Politische System Belgiens - Economic Theory And International Trade - Chromosomal Aberrations - Sich Schn Machen - Transfer In Schulentwicklungsprojekten - Einhrung In Die Praktische Pharmazie Apothekerpraktikanten - Der Antagonismus Frankreichs Und Englands Vom Politisch-militairischen Standpunkte Und Die Wahrscheinlichkeit Einer Franzsischen Truppenlandang Auf Der Englischen Sdkste - Rechtsextremismus Und Fremdenfeindlichkeit - Hunger Und Unterernhrung - Peter Weiss - Soziales Deutschland - Soziologie In Deutschland - Neues Jahrbuch Dritte Welt - Identification Of Lichen Substances - An Atlas Of Rectal Endosonography - Praktisches Baustellen-controlling - Praxis Der Abwasserreinigung - Preismanagement Im Privatkundengeschft Von Banken - Klassische Diesel-einspritzsysteme - Politische Techniksteuerung - Das Geteilte Leben - Export Import Spedition - Die Umworbene Gesellschaft - Moderne Identitt Und Gesellschaft - Das Management Von Stoffstrmen - Hlen Und Hren - Soziale Zeit Und Biographie - Algebra Funktionalanalysis Und Codierung - Muttersprache · Identitt · Nation - Interpretative Sozialforschung - Grundwissen Sozio-marketing - Einhrung In Die Betriebswirtschaftliche Organisationslehre - Prozessorientierte Methoden In Der Arbeits- Und Organisationsforschung - Kultur In Der Stadt - Global Denken Global Gewinnen - Die Pdiatrie Meiner Zeit - Teilchenphysik Aus Heutiger Sicht - Photosynthesis - Analyse Der Fette Und Wachsarten - Handwrterbuch Des Postwesens - 100 Jahre Schiffbautechnische Gesellschaft - Modern Treatment Of Severe Burns - Die Krankenpflege In Der Chirurgie - Funktionalisierung Von Duroplastischen Faserverbundwerkstoffen Durch Hybridgarne - Einhrung In Die Markscheidekunde Mit Besonderer Bercksichtigung Des Steinkohlenbergbaues - Reformierung Des Gesundheitssystems Oder In Welchem Gesundheitssystem Wollen Wir Leben - The Chinese Face In Australia - Grundlagen Der Konstruktion - Inside Wall Street - Erddrucktheorien - Beitrge Zur Geschichte Der Naturwissenschaften Und Der Technik - Db22 Kompakt - Die Methode Der Festpunkte Zur Berechnung Der Statisch Unbestimmten Konstruktionen Mit Zahlreichen Beispielen Aus Der Praxis Insbesondere Ausgehrten Eisenbetontragwerken - Chronische Conjunctivitis Trockenes Auge - Stochastik Einsteiger - Freiheit Wovon Freiheit Wozu - Dermatologie Und Rheuma - Individualisierung Und Integration - Numerische Methoden In Der Technik - Digital Control Systems - Fluid- Und Wrmetransport Strmungslehre - 4 Kongrey Der Deutschen Gesellschaft Intraokularlinsen Implantation - Kinder-rituale Zwischen Vorder- Und Hinterbhne - James Watt Und Die Grundlagen Des Modernen Dampfmaschinenbaues - Analysis Mit Mathematica Und Maple - Mandantenorientierte Sachbearbeitung - Vom Wert Der Natur - Anleitung Zur Entwicklung Elektrischer Starkstromschaltungen - Soziale Distanz - Net Kids - Politischer Extremismus In Der Bundesrepublik Deutschland - Diffusion Processes - Practical Thoracoscopy - Bau Einrichtung Und Betrieb Ffentlicher Schlacht- Und Viehhfe - Giant Intracranial Aneurysms - Erzieherinnen In Beruf Und Freizeit - Anatomie Und Pathologie Der Spontanerkrankungen Der Kleinen Laboratoriumstiere - Traumatologie In Der Chirurgischen Praxis - Das Interkulturelle Lehrerzimmer - Aktuelle Theoriediskurse Sozialer Arbeit - Grundzge Der Starkstromtechnik - Elektrische Maschinen Und Antriebe - Medien Und Fremdenfeindlichkeit - Mediensozialisation - Die Stadt Des Neuen Bauens - Berichterstattung Zur Sozio-konomischen Entwicklung In Deutschland - Teilhabe Im Umbruch - Unser Alltag Ist Voll Von Gesellschaft - Reoperative Hand Surgery - Interkulturelle Kompetenz In Der Verwaltung - Sozialpsychologische Entwicklungstheorien - œber Zahlen Und Spiele - Management Und Bilanzierung Von Emissionsrechten - Imaging Of Brain Metabolism Spine And Cord Interventional Neuroradiology Free Communications - Sammlung Der Internationalen Vereinbarungen Der Lnder Der Bundesrepublik Deutschland - Bestimmungsmethoden Enzyme - Lexikon Management - Vertrauen Und Wissen In Governance-prozessen - Koordinaten-geometrie - Der Modellbau Die Modell- Und Schablonenformerei - Variations And Connections Of The Human Thalamus - Individualisierung Und Soziale Reproduktion Im Lebensverlauf - Kostenberechnung Im Ingenieurbau - China Champions - Die Tierwelt Der Alpen - Isse 2011 Securing Electronic Business Processes - Publizistik Im Vernetzten Zeitalter - Literaturtheorie Und Geschichte - Elektronische Kommunikation X400 Mhs - Allgemeine Energiewirtschaft - Aktuelle Medientrends In Den Usa - Tropical Forestry Handbook - Gewerkschaften Ohne Vollbeschftigung - New Developments For Limb Salvage In Musculoskeletal Tumors - Politikwissenschaft Und Politische Bildung - Das Vlkerrecht - Prozeyinformatik - Materia Medica Of New And Old Homeopathic Medicines - Die Selbstkostenberechnung Im Fabrikbetriebe - Gesellschaft Mit Beschrnkter Hoffnung - Developmental Neuropathology - Neubewertung Der Familienarbeit In Der Sozialpolitik - Media Manager - Hmatologie Und Onkologie - Die Linearen Differenzengleichungen Und Ihre Anwendung In Der Theorie Der Baukonstruktionen - Die Heiz- Und Lftungsanlagen In Den Verschiedenen Gebudearten Einschlieylich Warmwasserversorungs- Befeuchtungs- Und Entnebelungsanlagen - Die Herz- Und Gefss-krankheiten - Encyclopedia Of Textile Finishing - Angiography Of The Human Brain Cortex - The Interferon System - Rundfunkpolitik Zwischen Sollen Wollen Und Knnen - Die Stumme Myokardischmie - Tick Vector Biology - Ostprofile - Integration Of Preference Analysis Methods Into Qfd For Elderly People - Mediensozialisation Von Heranwachsenden - Ferdinand Graf Von Zeppelin - œbergnge - Unter Der Brcke Rechts - Basic Im Bau- Und Vermessungswesen - Viskoelastika Eine œbersicht - Mechanik Der Kontinua - Gestaltung Regionaler Politik - Technologische Grundprozesse Der Vakuumelektronik - Partnerschaften Von Ngos Und Unternehmen - Eigenkapitalfinanzierung - Moderner Kaufmnnischer Schriftverkehr - Kinderlosigkeit In Deutschland - Automotive Simulation 91 - Integratives Mand A-management - Netzarchitektur Kompass Die Realisierung - Integriertes Geschftsprozessmanagement - Technische Mechanik Festigkeitslehre - Lebensstil Und Mortalitt - Schlank Intelligent Und Schnell - Schler Und Politik - Elektrotechnik Und Witterung - Der Kalium-natrium-austausch Als Energieprinzip In Muskel Und Nerv - Statik Und Prozess - Analysis And Simulation Of Semiconductor Devices - Lehmbau - Die Wechselwirkung Der Physischen Krfte - Ablage - Global Governance Und Ngos - Abwasserkonzepte - Fernsehkultur - Neue Ergebnisse Der Nervenphysiologie - Customer Banking - Organisation - Steinkohlenteer - Diathermie Heissluft Und Knstliche Hhensonne - Transport Phenomena In Porous Media - Dynamic Policies Of The Firm - Einhrung In Die Allgemeine Und Spezielle Vererbungspathologie Des Menschen - Die Isolierung Elektrischer Maschinen - Chemiker-taschenbuch - Das Mathematica Arbeitsbuch - Verkehrsmedizin - Karriere Machen Vertrieb 2003 - Geburtshilfliche Operationslehre - Hauptwerke Der Emotionssoziologie - Politische Philosophie Im Denken Heideggers - Insuring And Managing Hazardous Risks From Seveso To Bhopal And Beyond - Virologie Am Krankenbett - Region Und Nation - Qualittsmanagement In Der Praxis - Die Geteilte Utopie Sozialisten In Frankreich Und Deutschland - Frankreich Jahrbuch 2003 - Weiterbildung Zwischen Grundrecht Und Markt - Lebensbedrohliche Ventrikulre Herzrhythmusstrungen - Esd The Scourge Of Electronics - Aneurysmen Der Thorakalen Aorta - Vieweg C++ Toolbox - Klinische Rntgendiagnostik Des Dickdarms Und Ihre Physiologischen Grundlagen - Sexuelle Szenen - Proceedings Of The Xv Symposium Neuroradiologicum - Practical Android 4 Games Development - One-to-one- Marketing Im Internet - Der Flug Der Tiere - Beispiele Aus Der Baubetriebspraxis - Der Mathematikunterricht In Der Primarstufe - „sie Wollen Mir Doch Was Verkaufen! - „rztliche Merkbltter Ber Berufliche Erkrankungen - Spirituality Education And Society - Handbuch Der Katalyse - Opferschutz Im Strafverfahren - Fernsehgebrauch Und Geschlecht - Bauforschung Und Ihr Beitrag Zum Entwurf - Multikulturelle Demokratien Im Vergleich - Computer Und Menschliches Verhalten - Handbuch Der Rohrleitungen - Das Skizzieren Ohne Und Nach Modell Maschinenbauer - Metallurgy Of Welding - The Artificial Disc - Grundlagen Der œbertragung Elektrischer Energie - Beispiele Zur Mikroskopischen Untersuchung Von Pflanzenkrankheiten - Soziologische Abenteuer - Rechnen In Der Verfahrenstechnik Und Chemischen Reaktionstechnik - Familientraditionen Und Familienkulturen - Strategisches Kndigungsverhalten - Handbuch Der Thoraxchirurgie Encyclopedia Of Thoracic Surgery - The Internet For Surgeons - Mobilitt Lterer Menschen - Erkundung Von Verkehrswegen In Neulndern - The Art Of Accompanying And Coaching - Englands Privat- Und Handelsrecht - Was Schulden Wir Flchtlingen Und Migranten - Leadership - Best Practices Und Trends - Der Sektionskurs Kurze Anleitung Zur Pathologisch-anatomischen Untersuchung Menschlicher Leichen - Aufgabensammlung Elektrotechnik 2 - The Endocrine Control Of The Fetus - Philosophy Mathematics And Modern Physics - Pathology Of Multiple Pregnancy - Sozialkundestunden - Parteien Und Whler Im Umbruch - Chemie Der Zuckerindustrie - Bericht œber Die Siebenundvierzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1928 - Mutter + Vater = Eltern - Dezentrales Vernetztes Energiemanagement - Allgemeine Wechselstromlehre - Politikwissenschaft Die Soziale Arbeit - Das Glyzerin - Diagnose Und Therapie Der Gonorrhoischen Erkrankungen In Der Allgemeinpraxis - Mit Dem Krper Sprechen - Wie Unternehmen Sich Selbst Erneuern - Robotics And Factories Of The Future 87 - Die Sozialen Arbeitsverhltnisse Im Wandel Der Zeit - Statistik Leicht Gemacht - Die Trockene Destillation Des Holzes - Komatse Zustnde - Sonographische Diagnostik Des Skrotalinhalts - Familientypen Und Formen Auyerfamilialer Kinderbetreuung Heute - Beitrge Zur Angewandten Mikrokonomik - Der Elektrische Lichtbogen Bei Gleichstrom Und Wechselstrom Und Seine Anwendungen - Religion Bei Meinungsmachern - Grundgesetz Und Volksentscheid - Transosseous Osteosynthesis - Blutkonservierung Und Transfusion Von Konserviertem Blut - Politische Theorien In Russland - Spezialgebiete Der Gasdynamik - Einhrung In Die Empirische Sozialforschung - Geheimnisse - Interaktive Systeme - Helicobacter Pylori Gastritis And Peptic Ulcer - Produktklassiker - Schlkes Tafeln - Design Methods For Digital Systems - Handbuch Regierungsforschung - Beginning Android 4 Games Development - Die Malaria - Democratic Development - Meaning And The Growth Of Understanding - Die Sprache Des Traumes - Die Kontrolle Des Dampfkesselbetriebes In Bezug Auf Wrmeerzeugung Und Wrmeverwendung - Drogenhilfe Und Graumarkt - Energie Die Zukunft - Steuerung Versus Emergenz Entwicklung Und Wachstum Von Unternehmen - Wie Die Medien Die Welt Erschaffen Und Wie Die Menschen Darin Leben - Konforme Abbildung - Manual Of Neonatal Respiratory Care - Metastatic Bone Disease - Parlamente Und Ihre Funktionen - Mediation - Topographic Brain Mapping Of Eeg And Evoked Potentials - Die Auslndische Familie - Synaptic Plasticity In The Hippocampus - Steueroasen - Die Nato - Programmierte Einhrung In Die Betriebswirtschaftslehre - Bacillus Thuringiensis Biotechnology - Karsthydrogeologie - Medienwelten Im Wandel - œbungen Bankkaufleute - Im Umgang Mit Der Macht - International Compendium Of Numerical Data Projects - Internetstrategien Von Lokal- Und Regionalzeitungen - Ejnar Hertzsprung - Cytomechanics - Axial- Und Radialkompressoren - Ewige Kalender - Die Hochmolekularen Organischen Verbindungen - Kautschuk Und Cellulose - - Antarctic Nutrient Cycles And Food Webs - Die Cerebrospinalflssigkeit - Entwicklung Bau Und Bedeutung Der Keimdrsenzwischenzellen - Vertriebscontrolling Optimieren - Surgery Of Skull Base Meningiomas - Integrale Infrastrukturplanung - Allein Unter Frauen - Sharing Expertise Als Kern Von Wissensmanagement - Biologische Psychiatrie Der Gegenwart - Problems In Stellar Atmospheres And Envelopes - Rume Der Emanzipation - Aachener Bausachverstndigentage 2001 - Anlay- Und Regelwiderstnde - Bilanztheorie In Der Us-amerikanischen Und Internationalen Standardsetzung - Jugendliche In Marginalisierten Quartieren - Systematic Geomorphology - Fremdenfeindlichkeit Und Rechtsextremismus - Technologiegesttzte Dienstleistungsinnovation In Der Gesundheitswirtschaft - Menschenrechte Und Europische Auyenpolitik - Kunstglieder Und Orthopdische Hilfsmittel - Das Private Und Die Technik - Die Lehre Von Den Kettenbrchen - Benzin Benzinersatzstoffe Und Mineralschmiermittel Ihre Untersuchung Beurteilung Und Verwendung - Nuclear Non-proliferation - Ostdeutsche Jugendliche - Sleep Related Disorders And Internal Diseases - Biographie Und Technikgeschichte - A Guide To Addiction And Its Treatment - Die Forstliche Bestandesgrndung - Die Zentrifugalpumpen - Deutschland Und Polen Eine Werte- Und Interessengemeinschaft - Periphere Osteosynthesen - Sozialstaat In Europa - Auffallen Oder Anpassen - Erstes Jahrbuch Des Kriegsspitals Der Geldinstitute In Budapest - Moderne Kniegelenkdiagnostik - Pneumologische Umweltmedizin - Freiwilligenagenturen In Deutschland - Tumours In Urology - Grundlagen Und Methoden Aufsuchender Jugendarbeit - Die Stadt Das Fremde Und Die Furcht Vor Kriminalitt - Dormagener Qualittskatalog Der Jugendhilfe - Auswahl Von Standard-applikations-software - Hilfsbuch Mineralltechniker - Die Flssigen Brennstoffe - Die Lungentuberkulose - Abtastregelung - Vom Fachexperten Zum Wissensunternehmer - Professionalitt Sozialer Arbeit Und Hochschule - Die Hypertoniekrankheiten - Lehrbuch Der Speziellen Pathologie Und Therapie Der Inneren Krankheiten Studierende Und „rzte 1-30 Aufl Leipzig Fcw - New Energy Conservation Technologies And Their Commercialization - Telematik Im Strayenverkehr - Starthilfe Chemie - Advances In Ct Ii - Bildung Im Ritual - Die „erfolgsspirale Der Ungleichzeitigkeit - Die Akuten Infektionskrankheiten Des Kindesalters - Die Entstehung Von Groyeisenindustrie An Der Deutschen Seekste - Der Arbeiterschutz In Den Preussischen Bergpolizeiverordnungen - Fehlzeiten Wirksam Reduzieren - Lehrbuch Der Maschinendynamik - Reliability Data Collection And Use In Risk And Availability Assessment - Proceedings Of A Conference On Local Fields - Die Vervielfltigung Von Zeichnungen Insbesondere Von Technischen Zeichnungen - Hegels Philosophie Des Subjektiven Geistes Hegel Philosophy Of Subjective Spirit - The Developing Marsupial - Lehrbuch Der Metallkunde Des Eisens Und Der Nichteisenmetalle - –kologie Und Wasserbau - Histologie Der Hautkrankheiten - Baubetriebslehre - Projektmanagement - Economic And Financial Knowledge-based Processing - Invasive Kardiologie - Black-box Models Of Computation In Cryptology - Kleiner Ratgeber Den Apothekenkauf - Pascal Wirtschaftswissenschaftler - Der Islamische Fundamentalismus Der Islam Und Die Demokratie - Landesparlamentarismus - Stoffwechsel Der Landwirtschaftlichen Nutztiere - Rntgendiagnostik Des Herzens Und Der Grossen Gefsse - Facets Of Vision - Der Wrmebergang An Strmendes Wasser In Vertikalen Rohren - Fluktuationen Und Dynamik Aktiver Halbleiter-bauelemente - Stahlbau Und Baustatik - Advances In Superconductivity Iii - Solarzellen - Programmieren In Prolog - Konstruktionslehre Den Maschinenbau - Erfolgreiche Strategien Die Kundenbindung - Baustatik - Geschichte Der Homopathie - Produktion Als Wettbewerbsfaktor - Manager Und –kologie - Vertrauen Und Glaubwrdigkeit - Starthilfe Strmungslehre - Wertbewusstes Controlling - Das Interview In Der Psychologie - Variation-aware Design Of Custom Integrated Circuits A Hands-on Field Guide - Bandstrayen Im Baubetrieb - Ditetische Kche Klinik Sanatorium Und Haus - Diskurs-inszenierungen - Internationalisation And Mode Switching - Rckreise In Die Vergangenheit - Qualittsmanagement Und Zertifizierung - Rechtsstaat Und Demokratie - Vibration And Coupling Of Continuous Systems - Radiologie Trger Des Fortschritts - Geschichtsunterricht Im Demokratischen Staat - Bone Metastases - Analysis - Arbeitsbuch - –kologische Kommunikation In Deutschland - Nichtlineare Dynamik Bifurkation Und Chaotische Systeme - Fernsehwerbung Quo Vadis - Wahlen Und Europische Einigung - Coronary-prone Behavior - Die Strukturkrise Der Strukturpolitik - Controlling Im Handel - Was Lsst Ehen Heute Noch Gelingen - Grundzge Der Botanik - Technischer Lehrgang Hydraulische Systeme - Iron Metabolism - Brokommunikation Von Der Planung Bis Zur Erfolgskontrolle - Die Kologische Benachteiligung Der Tropen - Initial Boundary Value Problems In Mathematical Physics - Stent-implantationen Und Vaskulre Mr-diagnostik - Operations Research - Bilanzkennzahlen - Einhrung In Die Technische Behandlung Gasfrmiger Stoffe - Das Kniegelenk - Programmieren In Smalltalk Mit Visualworks - Solution Chemistry Of Surfactants - Wissenschaftssoziologie - Online Searching On Stn - Freies Skizzieren Ohne Und Nach Modell Maschinenbauer - Diskurs Und Entscheidung - 28th International Symposium On Shock Waves - Journalistik - Mechanisms And Phylogeny Of Mineralization In Biological Systems - Grundriss Der Pharmaceutischen Maassanalyse - Herausforderungen An Die Innovationskraft Der Verwaltung - Business Ethics - Anlage Ausbau Und Einrichtungen Von Frberei- Bleicherei- Und Appretur-betrieben - Microsoft Publisher Einsteigen Leichtgemacht - Das Tonwerk Im Rechtssinne - Karriere In Der Finanzwelt - Der Anspruch Auf Ein Patent Und Das Recht An Der Erfindung - Objektive Mglichkeit - Die Politische Philosophie Michael Walzers - Staatliche Institutionenbildung In Ostdeutschland - Doing Social Problems - Die Wirkungsweise Der Rektifizier- Und Destillier-apparate Mit Hilfe Einfacher Mathematischer Betrachtungen - Das Photographische Objektiv - Die Nachbehandlung Nach Chirurgischen Eingriffen - Das Reichsgesetz Betreffend Den Ausbau Der Deutschen Wasserstrayen Und Die Erhebung Von Schiffahrtsabgaben Vom 24 Dezember 1911 - Grundzge Der Zerspanungslehre - Urtikaria - Grundlagen Von Informationssystemen - Fetal Growth - Arbeitsrecht 2 - Musikfernsehen In Deutschland - Die Pflegeversicherung - Die Gifte In Der Weltgeschichte - Marketing Entscheider - Frauen In Der Kleinbuerlichen Landwirtschaft - Grne Parteien In Westeuropa - 100 Rezepte Excel 50 - Grenzen Und Grenzberschreitungen Der Liebe - Gynkologische Operationstechnik - Management Von Marktpreis- Und Ausfallrisiken - Systematisches Projektieren Und Konstruieren - Literatursoziologie - Traumatologie Der Peripheren Nerven - Sanierung Und Facility Management - Das Problem Der Industriearbeit - Felix Hausdorff - Gesammelte Werke Band Ia - Allgemeine Und Spezielle Chirurgie Des Kopfes Einschliesslich Operationslehre Unter Besonderer Bercksichtigung Des Gesichts · Der Kiefer Und Der Mundhhle - Die Anwendung Der Nomographie In Der Mathematik - Tatort Biographie - Cultural Diversity In The Classroom - Regulierung Und Unternehmenspolitik - Journalisten Im Netz - Terminhandel - Technische Mechanik 2 - Akupressur Und Moxibustion - Chirurgie Anorektaler Krankheiten - Ebene Und Rumliche Rahmentragwerke - Die Krankheiten Der Endokrinen Drsen - Sicherheit Durch Gemeinschaft - Variational And Finite Element Methods - Professionalisierung Der Politikvermittlung - State-of-the-art In Computer Animation - Die Schaltungsarten Der Haus- Und Hilfsturbinen - Handbuch Sexualstraftaten - Wrme- Und Klteschutz - Coal-bearing Depositional Systems - Festivalisierung Der Stadtpolitik - Internationale Umweltpolitik - Physik Mit Dem Pc - Jugendlicher Rechtsextremismus Und Gewerkschaften - Optimale Produktions- Und Absatzplanung - Vernetzte Organisationen - Strfall Gender - Geologische Voraussetzungen Wasserkraftanlagen - Pdiatrie - Management Von Diskontinuitten - Zivilisation Und Rationalisierung - Einhrung In Die Deutsche Literatur Des 12 Bis 16 Jahrhunderts - Advanced Android 4 Games - Die Goliath-falle - Progress In Pacific Polymer Science 2 - Zeitaufwand Tafeln Die Kalkulation Von Strayen-und Tiefbauarbeiten - Bodenbildung Und Bodeneinteilung - Handbuch Der Physikalischen Maassbestimmungen - Statical And Geomechanical Models - Bankenaufsicht - Gewaltpotentiale Des Fernsehangebots - Handbuch Der Kommunalen Sozialpolitik - Angewandte Tensorrechnung - Ausgewhlte Chemische Untersuchungsmethoden Die Stahl- Und Eisenindustrie - –ffentlichkeit Und Sprachwandel - Rstungskooperation Und Technologiepolitik Als Problem Der Westeuropischen Integration - New Trends In Management Of Cerebro-vascular Malformations - Qualitative Forschung In Der Sozialpdagogik - œbungsbuch Zur Angewandten Wahrscheinlichkeitstheorie - Die Staatengesellschaft Im Globalisierungsprozess - Quantenbiologie - Systeme Und Subjektstrukturen - Introduction To Mineralogy - Arbeiten Im Virtuellen Zeitalter - Die Generation Der Wende - Rechtsextremismus - Vernetzte Sicherheit - Moral Kommunikation Organisation - Das System Der Politik - Allgemeine Theorie Der Menschlichen Haltung Und Bewegung - Israel In Nahost Deutschland In Europa Nahtstellen - Elementare Moderne Physik - Die Elektrische Futterkonservierung - Sozialer Umbruch Und Kriminalitt In Deutschland - Die Rede Des Kanzlers - Eigentumswohnungen Als Kapitalanlage - Vision Und Wandel - Advances In Surgery For Cerebral Stroke - Gerontopsychiatrie Und Alterspsychotherapie In Deutschland - Handbuch Des Normalen Und Gestrten Schlafs - Molecular Genetics Biochemistry And Clinical Aspects Of Inherited Disorders Of Purine And Pyrimidine Metabolism - The Endothelins - Buchhrung Und Bilanz - Innovative Unternehmenskommunikation - Die Selbstttige Regelung - Grundlagen Der Gestaltung - Ein Vorschlag Zur Eherechtsreform - Entterritoriale Politik - Objektorientierte Software In Der Kommerziellen Anwendung - Nherungsversuche Jugend 81 - Fokus Kunde - Die Edelmetalle - Gesellschaftsbilder Im Umbruch - Snack Food Technology - Dictionary Of Food And Ingredients - Erziehungswissenschaft - Erfahrung Und Technik In Der Produktion - Lehmbau Regeln - Klteprozesse - Der Lndliche Raum - Der Nahrungsbedarf Des Menschen - Der Bau Der Erde Und Die Bewegungen Ihrer Oberflche - Niedersachsen-lexikon - Das Skizzieren Von Maschinenteilen In Perspektive - Handwrterbuch Zur Lndlichen Gesellschaft In Deutschland - Mobile Payment - Das Eigene Leben Leben - Foundational Java - Forschung Und Technik - Vom Zukunfts- Zum Auslaufmodell - Kranbahntrger Aus Walzprofilen - Rate Adaptive Cardiac Pacing - Sozialpolitische Strategien Gegen Armut - Das Mediensystem Der Bundesrepublik Deutschland - Digital Audio Restoration - Innovation Und Internationalisierung - Sanierung Von Metallbauteilen - –ffentliche Verwaltung In Deutschland - Data Expert Knowledge And Decisions - Juristische Logik - Betriebseinrichtungen Der Textilveredelung - Interne Revision - Klinik Der Rheumatischen Erkrankungen - Tribologie-handbuch - Spasticity - Learn Cocos2d Game Development With Ios 5 - Lebensversicherungsmedizin - Soziologische Ausflge - Blutdruck Unter Krperlicher Belastung - Autocad Praktikum - Das Telephon Und Sein Werden - Modernization Science - Mnnergewalt Gegen Frauen Beenden - Deutsche Europapolitik Von Konrad Adenauer Bis Gerhard Schrder - Festkrperspektroskopie - Die Psychosoziale Situation Von Auslndern In Der Bundesrepublik - Augenrztliche Eingriffe - Progress In Proctology - Urbanitt - Glck Logik Und Bluff - Bowling Together - Die Inszenierung Des Politischen - Atlas Of Slices Of The Temporal Bone And Adjacent Region - Auf Dem Weg Nach Europa - Die Entwicklung Des Verkehrs - Application Development Systems - Manual Der Osteosynthese - M©ni¨re Disease - Perspektiven Verurteilter Wirtschaftsstraftter - Theoretische Biochemie - Handbuch Der Balneologie Und Medizinischen Klimatologie - Fractals And Disordered Systems - Bird Migration - Grundriss Der Entwicklung Des Menschen - Kreatives Hrungsverhalten - Lehrbuch Der Bder- Und Klimaheilkunde - Darstellende Geometrie Maschineningenieure - Ambivalenz - Ergebnisse Der Immunittsforschung Experimentellen Therapie Bakteriologie Und Hygiene - Plant Cell And Tissue Culture - Benzodiazepines And Therapeutic Counselling - Wohlfahrtsstaat Im Wandel - Die Brennkraftmaschinen - Emil Fischer - Equilibrium And Kinetics In Contact Metamorphism - Advances In Turbulence - Transitionen In Der Bildungsbiographie - Korruption - Arteriosclerosis - Die Wissensordnung - Habitusanalysis 1 - Dynamik Der Kraftfahrzeuge - Diagnosis And Management Of Melanoma In Clinical Practice - Die Kunstseide Und Andere Seidenglnzende Fasern - Lie-gruppen Und Lie-algebren - Nachhaltigkeit - Die Entwicklung Der Zahnrad-technik - Der Soziologische Blick - Advances In Nuclear Physics - Fanconi Anemia - Ernst Curtius - Die Organischen Wurƶeln Der Lautsprache Des Menschen - Lernen In Der Informationsgesellschaft - Stoffstromanalysen - Anticarcinogenesis And Radiation Protection - Handbuch Soziale Probleme - Arbeitsbltter Friseure - Gewichtung In Der Umfragepraxis - Furcht Und Freiheit - Arzt Und Private Krankenversicherung - Das Erfolgreiche Einstellungs-interview - Lan Praxis Lokaler Netze - Anthropologische Medizin - Tragwerkslehre In Anschauungsmodellen - Der Richter Wesen Und Verfassungsrechtliche Stellung - Elektrotechnik Und Elektrische Antriebe - Wilhelm Conrad Rntgen Und Die Geschichte Der Rntgenstrahlen - Lunge-berl Chemisch-technische Untersuchungsmethoden - Chemisch-technische Untersuchungsmethoden Ergnzungswerk Zur Achten Auflage - Die Drehzahl-normung Und Ihre Wirtschaftliche Auswirkung Im Drehbankbau - Politische Reprsentation Schwacher Interessen - Vermessungskunde 1 - Biomechanik - Sozialisation In Kologischer Perspektive - Water And Life - Supramolekulare Chemie - Grundbau - Erziehungswissenschaftliche Zugnge Zur Waldorfpdagogik - Kulturpolitik Und Nationale Identitt - Elektro-fachrechnen 1 - Satellite Communications - Was Will Die Jngere Mit Der Lteren Generation - Bilanzpolitik - Alter Und Methode - Allgemeine Energiewirtschaftslehre - Die Kunst Der Demotivation - Die Blattrollkrankheit Der Kartoffel - Chemie Des Bauwesens - Einwanderungsland Hessen - High Energy Astrophysics - Parallele Digitale Optische Recheneinheiten - Digital Memory And Storage - Joint Ventures In Den Gus-staaten - Forschung Mit Rntgenstrahlen - Atlas Der Anatomie Des Menschlichen Krpers Im Rntgenbild - Die Globale Wettbewerbsstrategie - Corporate Hospitality Bei Sportevents - Materialien Zur Soziologie Des Alltags - Computational Nuclear Physics 1 - Allgemeines Versicherungsvertragsrecht - Auswrtiges Amt - Symbole Der Politik Politik Der Symbole - Der Geburtshilfliche Phantomkurs In Frage Und Antwort - Medikamentse Behandlung Des Postinfarktpatienten Nach Cast - Sprichwrter Und Redensarten Im Interkulturellen Vergleich - Fernsehfinanzierung - Integrated Pollution Control - Grundriss Der Allgemeinen Chirurgie - Elektrotechnik Auf Handelsschiffen - Nbd-prognosemodelle Im Kundenbeziehungsmanagement - Modern Production Concepts - Chemisch-technische Untersuchungsmethoden - Psychologie Sozialer Prozesse - Graphische Kinematik Und Kinetostatik Des Starren Rumlichen Systems - Structure And Change In The Space Economy - Lnder-parlamentarismus In Deutschland - Die Neueren Wandlungen Der Elektrischen Theorien - Aus Der Praxis Der Kinderchirurgie - Grundkurs Theoretische Physik 6 Statistische Physik - Umweltgeochemie - Leitgedanken Einer Neuzeitlichen Werkstoff-forschung - 40 Jahre Hessische Verfassung 40 Jahre Politik In Hessen - Feldanalyse Als Forschungsprogramm 2 - Strategisches Affinity-group-management - Bildung Autonomie Tradition Und Migration - Expertensystemshell Deduc Wissensdynamik Mit Deduc - Computational Fluid Dynamics Based On The Unified Coordinates - Insolvenzrecht - Paramecium - Vorlesungen Ber Mathematische Statistik - Second Generation Expert Systems - Geschichte Der Eisendrahtindustrie - Contributions To Functional Analysis - Medizinische Kommunikation - Angst Wegspielen - Die Alten Und Das Netz - Ganzheitliches Direktmarketing - Lautlos Hren - Die Werkzeuge Und Arbeitsverfahren Der Pressen - Die Physikalische Komponente Der Pflanzlichen Transpiration - Functional Morphology Of The Endocrine Heart - Quantum Chemistry Of Organic Compounds - Taking Your Ipad To The Max Ios 5 Edition - Einhrung In Die Quantenmechanik Und Ihre Anwendungen - Grundlagen Des Dokumenten-managements - Language Grounding In Robots - Modern Triz - Xith International Astronautical Congress Stockholm 1960 - Regional Advantage And Innovation - Assessment Center - Der Verband Der Hochschullehrer Betriebswirtschaft - Adaptations To Terrestrial Environments - Kontext Akteur Und Strategische Interaktion - Atlas Of Nuclear Cardiology - Mythos Familie - Die Wirtschaftliche Arbeitsweise In Den Werksttten Der Maschinenfabriken - Die Anfertigung Forstlicher Terrainkarten Auf Grund Barometrischer Hhenmessungen Und Die Wegnetzprojectirung - Morphological Astronomy - Ertrgnisse Deutscher Aktiengesellschaften Vor Und Nach Dem Kriege - Der Grundbau - Theorie Und Berechnung Von Tragwerken - Climate Change And Rice - Atemtherapie Kinder - Selbstbestimmung Als Konstruktion - More Ios 6 Development - Rechtsquellen Zum Steuerstandort Liechtenstein - Peptides As Probes In Muscle Research - Das Wort Hat Der Herr Bundeskanzler - Acta Historiae Neerlandicae Ix - Hair And Hair Diseases - Jugend Und Jugendpolitik In Benachteiligten Stadtteilen In Europa - Geometrie Und Symmetrie In Der Physik - Handbuch Laser-strahlenschutz - Lehrbuch Der Entwicklungsgeschichte Des Menschen - Diseases Of The Salivary Glands Including Dry Mouth And Sjgren Syndrome - Biotechnology In Japan - Chancengleichheit Im Bildungswesen - Einhrung In Die Abfallwirtschaft - Cervical Spine I - Fernsehen Als Objekt Und Moment Des Sozialen Wandels - Der Bundesprsident Im Politischen System - Allgemeine Und Spezielle Physiologie Des Menschenwachstums - Ambulantes Blutdruckmonitoring - Workflow-management In Verteilten Systemen - Soziale Arbeit Den Aktivierenden Staat - Berechnungsverfahren Zur Bestimmung Der Kritischen Drehzahlen Von Geraden Wellen - Die Ffentliche Meinung In Der Auyenpolitik - Innovation Technik Zukunft - Primate Vocal Communication - Dienstleistungsqualitt - Theoretical Physics On The Personal Computer - Die Dreidimensionale Ultraschalldiagnostik - Algorithmen Ingenieure - Applications Of Laser Anemometry To Fluid Mechanics - Principles Of Abrasive Water Jet Machining - Fundamental Beta - Chemische Ingenieur-technik - Automobil Verkehr Und Erziehung - Systematic Introduction To Expert Systems - The Hla System In Clinical Transplantation - Lehrbuch Der Ernhrungstherapie Innere Krankheiten - Handbuch Parteienforschung - Die Absatztechnik Der Amerikanischen Industriellen Unternehmung - Anlagechancen 2011 - Berufsziel Journalismus - Korruption In China - Mathematik Im Abendland - Psychodrama - Einhrung In Den Eurocode 3 - Forensische Psychopathologie - Das Fotoalbum Weierstray A Photo Album For Weierstrass - Praktikum Der Pflanzenanatomie - Soziale Netzwerke Und Internet-spielewelten - Praktischer œbersetzerbau - Bifurcations - Der Betriebskoeffizient Der Eisenbahnen Und Seine Abhngigkeit Von Der Wirtschaftskonjunktur - Hhere Mathematik Griffbereit - Der Waldwegbau Und Seine Vorarbeiten - Selektion In Der Heilanstalt 1939-1945 - Ernhrung Und Pflege Des Suglings - Zuverlssige Numerische Analyse Linearer Regelungssysteme - Antiarrhythmic Drugs - Vertriebsrecherche Leicht Gemacht - Die Industrielle Keramik - Sozialmanagement - Jugend Religion Und Modernisierung - Logistiknetzwerke - Integration Von Politischer Und –konomischer Bildung - Transition Metals And Organometallics As Catalysts For Olefin Polymerization - Aids - Beratung Coaching Supervision - Regierungssystem Und Regierungslehre - Handbuch Der Vergleichenden Anatomie Der Haustiere - Demokratie Als Erfahrung - Chirurgische Operationslehre - Der Schwierige Weg Zur Demokratie - Ehen Und Ihre Freundschaften - Handbuch Fernsehforschung - Hormone Des Ovariums Und Des Hypophysenvorderlappens - Austauschbare Einzelteile Im Maschinenbau - Shock Waves @ Marseille Iii - Plurale Sozialstrukturanalyse - Automation In The Food Industry - Einhrung In Die Physik Des Transistors - Perspektiven Der Arrhythmiebehandlung - Platelet Heterogeneity - Cross-border Venture Capital Investments - Gene Transfers And Environment - Calcium In Muscle Contraction - Das Asbestzement-druckrohr - Strategic International Marketing - Wissenschaft Zwischen Folgenverantwortung Und Nichtwissen - Medien Und –konomie - Die Auyenpolitik Kanadas - Das Biokybernetische Modell - Zusammenhalt Durch Vielfalt - Leitfaden Arithmetik - Grundlegung Einer Forstlichen Betriebslehre - Emotion Gesellschaft Und Kultur - Baroreceptor Reflexes - Lessons Learned From Long-term Soil Fertility Management Experiments In Africa - Kognitive Systeme - Gear Motor Handbook - Physik In Formeln Und Tabellen - Gefhrdete Jugendliche - Steckbriefe Von Armut - Cop Culture - Der Alltag Des Gewaltmonopols - Auto Und Verkehr Bis 2000 - Sozialerziehung In Der Schule - Ingenieurmathematik Kompakt Mit Maple - Fehlerwelten - Die Zerbrochene Wirklichkeit - Die Planungszelle - Cc++ Werkzeugkasten - Handbuch Medienerziehung Im Kindergarten - Gedanken Zur Naturphilosophie - Grundlegende Algorithmen - Intracellular Staining In Neurobiology - Lexikon Der Fertigungsleittechnik - Chronik Des Deutschen Forstwesens Im Jahre 1888 - Die Tierwelt In Heilkunde Und Drogenkunde - Die Geschichte Der Kinderheilkunde - Einfaches Pharmakologisches Praktikum Mediziner - Sucht Und Familie - Anleger-check Edelmetall-investments - Einhrung In Die Organische Stereochemie - Gabler Wirtschafts Informatik Lexikon - Ordnungsmacht Psychiatrie - Die Banken In Ihrer Gryten Krise - Wie Geht Es Weiter - Current Topics In Cybernetics And Systems - Stereotactic Techniques In Clinical Neurosurgery - Soziologische Aufklrung 2 - Das Krebsproblem - Angewandte Volkswirtschaftslehre - Drilling Mud And Cement Slurry Rheology Manual - Die Grundgesetze Der Wrmebertragung - Foundations Of Economic Development - Die Elektrischen Ausrstungen Der Gleichstrombahnen Einschlieylich Der Fahrleitungen - Internationale Kooperationen Und Joint Ventures - Institutionelle Kommunikation - Intestinal Anisakiasis In Japan - Die Berflssige Jugend Der Arbeitsgesellschaft - Kommentar Zur Schiedsgerichtsordnung Das Bauwesen - Klausurtraining Statik - œberflle Und Wehre - Afrika Jahrbuch 1988 - Die Grundlagen Der Verkehrswirtschaft - Die Berechnung Rotierender Scheiben Und Ringe Nach Einem Neuen Verfahren - Erythropoietin - Die Elbe Im Spannungsfeld Zwischen –kologie Und –konomie - Materials Sciences In Space - Lernziel Konkurrenz - Rollenspiele In Kommunikations- Und Verhaltenstrainings - Kundenerfahrungen Im Dienstleistungsprozess - C++ Toolbox For Verified Computing I - Between Two Worlds” Hans Gerth - Radiative Corrections For E+e- Collisions - Theorien Und Methoden In Den Sozialwissenschaften - Einhrung In Die Experimentelle Therapie - Nichtlineare Mechanik - Physical Property Prediction In Organic Chemistry - Aufgabensammlung Elektroingenieure - Die Grundzge Der Werkzeugmaschinen Und Der Metallbearbeitung - Lehrbuch Der Kinderheilkunde - Genderkompetenz In Supervision Und Coaching - Medizinische Mykologie In Praxis Und Klinik - Free Radical Reactions In Medicine - Einhrung In Die Kinderheilkunde - Intervention Kultur - Das Siebte Buch Objektorientierung Mit C++ - Interventionen Am Herzen - Das Gesundheitswesen In Der Bundesrepublik Deutschland - Kohlenstaubfeuerungen - Boundary Element Methods In Engineering - Atome Molekle Kerne - Handbuch Kulturpublikum - Erlebte Kinderheilkunde - Therapie Des Zervixkarzinoms - Praxiswissen Chemie Techniker Und Ingenieure - Statistische Thermodynamik - Die Theorie Der Beobachtungsfehler Und Die Methode Der Kleinsten Quadrate Mit Ihrer Anwendung Auf Die Geodsie Und Die Wassermessungen - Das Blech Und Seine Prfung - Wolfgang Abendroth Wissenschaftlicher Politiker - Lebenslanges Lernen Im Beruf Seine Grundlegung Im Kindes- Und Jugendalter - The Physiology Of The Compound Eyes Of Insects And Crustaceans - Adhesives Technology Compendium 2011 - Nahost Jahrbuch 2003 - Infected Total Joint Arthroplasty - Prfungsvorbereitung Bwl - Schwestern - Der Alltgliche Kampf In Organisationen - Integrierte Produktentwicklung - Mr-angiographie Und Mr-tomographie Des Gefysystems - Abwasserhydraulik - Dehnungsmeystreifentechnik - Kompendium Der Frauenkrankheiten - Einhrung In Die Chemische Physiologie - Principles Of Wood Science And Technology - Lohmeyer Stahlbetonbau - Hard Tissue Mineralization And Demineralization - Ausgrenzung Macht Krank - Bilanzpolitik Und Kreditvergabeentscheidungen - Transformationsprozesse In Deutschland - Essays On Production Theory And Planning - Experimentelle Psychologie In Demonstrationen - Biochemische Grundlagen Der Disposition Karzinom - Chronic Pancreatitis - Data Compression - Konflikte Zwischen Vorstand Und Geschftshrer In Nonprofit-organisationen - Pathophysiologie Und Rationale Pharmakotherapie Der Myokardischmie - Automobillogistik - Diabetes Mellitus - Biomedical Ethics And The Law - Kompetent In Die –ffentlichkeit - Elektrische Starkstromanlagen Maschinen Apparate Schaltungen Betrieb - Das Surebestndige Email Und Seine Industrielle Anwendung Im Apparatebau - Unternehmen Im Wettbewerb - Gasentladungs- Tabellen - Wissens- Und Informationsmanagement - Temporale Muster - Transportation For The Future - Druckverteilung Im Baugrunde - Auyenwirtschaftslehre - Festschrift Die Wirklichkeit - Der Krper Im Biographischen Kontext - Das Neue Arbeitsrecht - Konflikte Im Betriebsrat Als Lernanlass - Macromolecules - Medien Im Wandel - Azospirillum Iv - œberbetriebliche Vernetzung Im Handel - Die Integrationsfunktion Der Massenmedien - Grund- Und Wasserbau In Praktischen Beispielen - Governing The Uncertain - Werkzeugspanner Werkzeughalter - Urbane Bden - Peripheralization - Informationstechnologie Ingenieure - Tumormarker Und Immunszintigraphie In Der Gynkologischen Onkologie - Erfolgreiches It-management In Der Praxis - Acute Pancreatitis - Anton Dohrn - Umweltorientierte Lebenszyklusrechnung - Sozialisation Zur Mitbrgerlichkeit - Die Wohlfahrtseinrichtungen Von Groy-berlin - Elektrochirurgie Am Auge - Geschichte Der Rbe Beta Als Kulturpflanze - Neue Entwicklungen In Der Therapie Von Lebertumoren - Contemporary Research Methods In Neuroanatomy - Mikrowellenmesstechnik - Schwarzes Geld And Weiye Weste - Die Bank Der Zukunft - Die Wirtschaftlich Gnstigste Spannung Fernbertragungen Mittelst Freileitungen - Kreativitt Und Improvisation - Fit Den Generationswechsel Im Unternehmen - Handbuch Stadtsoziologie - Eifersucht Bewltigen - Wirtschaftliche Entwicklung Bei Schrumpfender Bevlkerung - Korea - Anorganisch-nichtmetallische Werkstoffe - Kinderrepubliken - Organoselenium Chemistry I - Die Angepassten Provokateure - Mensch-computer-kommunikation - Fallsammlung Steuerlehre Rechnungswesen - Lehrbuch Der Theoretischen Physik - Die Preuyischen Apothekengesetze - Kommentar Zur Vorlufigen Landarbeitsordnung Vom 24 Januar 1919 Nebst Einem Abdruck Der Bestimmungen Ber Die Anwerbung Und Beschftigung Auslndischer Arbeiter - Kompakt Im Doppelpack Html Und Javascript - Wechselmodell Psychologie Recht Praxis - A Brief History Of Computing - Patterns Programming And Everything - Palliative Krebstherapie - Turbo-pascal In Beispielen - Bav - Der Neue Versorgungsausgleich - Massivbau - Elektronische Demokratie - Die Grundlagen Der Erbbiologie Des Menschen - Statistical And Computational Techniques In Manufacturing - Early Pregnancy Loss - Kompendium Der Analysis - Ein Kompletter Bachelor-kurs Von Reellen Zahlen Zu Partiellen Differentialgleichungen - Management-trainings - Das Frben Von Papier - Intersections Without Traffic Signals Ii - Unternehmensverkauf - Differenzengleichungen Und Diskrete Dynamische Systeme - Ohne Panik Strmungsmechanik! - Beginning Ios Storyboarding - Familienunternehmer Heute - Softwareentwicklung Nach May - Nachhaltige Quartiersentwicklung - –konomie Und Mathematik - Bioproducts And Bioprocesses - Charakter Und Umwelt - Lehrbuch Der Geburtshilfe - Zur Aktualitt Von Jean Baudrillard - Die Innovationsfhigkeit Der Organisationsgesellschaft - Elektronenmikroskopische Methodik - Kompetenzmanagement In Der Praxis - Ernhrungs- Und Stoffwechselkrankheiten Und Ihre Behandlung - Empowering Open And Collaborative Governance - œber Die Rechtfertigung Wirtschaftlichen Handelns - Von Der Kundenorientierung Zum Supply Management - Enzyme Handbook 4 - Handbuch Der Verkehrsmedizin - œbergang Zur Erwerbsttigkeit - Bericht Ber Die Sechsundvierzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1927 - Organtransplantation In Rats And Mice - Harderian Glands - Die Quarzlampe Und Ihre Medizinische Anwendung - Kosmetik - Jahresbericht Ber Die Beobachtungs - Ergebnisse - Elektrotechnische Winke Architekten Und Hausbesitzer - Reaching Algebra Readiness Rar - Spielen Frauen Ein Anderes Spiel - Wohlfahrtskulturen In Frankreich Und Deutschland - Isdn The Integrated Services Digital Network - Physics For A New Generation - The Global Victimization Of Children - Militr Als Lebenswelt - Schritte Zum Nachhaltigen Unternehmen - Stadtentwicklung In Ostdeutschland - Handbuch Industrieroboter - Bildtafeln Die Genetische Beratung - Famotidin Heute - Control Mechanisms In The Nervous System - Grundlagen Der Errichtung Elektrischer Anlagen In Explosionsgefhrdeten Betrieben - Herz Und Diabetes - Kinderreiche Mtter - Hchstspannungs-tagung Essen - Abschied Vom Management - Chemical Water And Wastewater Treatment Iii - Wahlen In Postsozialistischen Staaten - Lindenstraye - Theoretische Grundlegung Ethischer Bankbetriebslehre - Ergebnisse Und Probleme Der Modernen Anorganischen Chemie - Der Regierungsbezirk Hannover - Photoreceptor Optics - Enzyme Handbook 7 - Homotopy Analysis Method In Nonlinear Differential Equations - Die Archologie Der Zeit - Management Kreativer Prozesse - Institut X - Instrumental Methods And Scoring In Extrapyramidal Disorders - Bankdienstleistungen Kundenorientiert Verkaufen - Arzneimittel Und Verantwortung - Bankmarketing Im Firmenkundengeschft - Botanisch-geologische Spaziergnge In Der Umgegend Von Berlin - Anatomie Und Technik Der Leitungsansthesie Im Bereiche Der Mundhhle - –konomie Der Nachhaltigkeit - Neue Finanzdienstleistungen - Ziegler Catalysts - Jugend Arbeit Und Identitt - Deutsche Waschmittelfabrikation - Lgner - Die Englische Aktien-gesellschaft Nach Neuem Recht - Die Entwicklung Des Soziologischen Wissens - Clinical Pharmacology Of Anti-epileptic Drugs - Regieren In Der Bundesrepublik Ii - Bausteinbasierte Software - Die Kulturelle Bedeutung Der Komplexen Psychologie - Parlamentarische Mitsteuerung - Gruppenarbeit - Unternehmenserfolg Durch Marktorientierte Hrung - Die Lehre Neu Verstehen Die Wissenschaft Neu Denken - Density Functional Theory - Tragwerkselemente - Neural Networks For Identification Prediction And Control - Privatschulen Versus Staatliche Schulen - Rntgendiagnostik Der Leber - Organisationsmanagement Internationaler Unternehmen - Prognoserechnung - Freizeit In Der Erlebnisgesellschaft - Die Chemie Bearbeitet Als Bildungsmittel Den Verstand - Principles Of Dispersal In Higher Plants - Bericht Ber Die Zweite Tagung Ber Psychopathensorge - Ehrenamt Und Brgerschaftliches Engagement Im Recht Ein Ratgeber - Die Neue Rechte Und Die Berliner Republik - Fit Im Bro - Die Untersuchung Und Beurteilung Des Wassers Und Des Abwassers - Die Lehren Der Forstwissenschaft - Brcken - Streitgesprche - Intention Bedeutung Kommunikation - Renal Transport And Diuretics Renaler Transport Und Diuretica - "ihre Werte Bitte!" - Ethics And Human Genetics - Erziehung Durch Arbeit - Wissenschaft Und Technologie Acht Milliarden Menschen - Fremdenfeindliche Gewalttter - Controlling Von Projekten - Viewegs Geschichte Der Technik - Integrated Usage Mining - Tops 10 - Der Jungunternehmer - Qualitative Psychologie - Prozey- Und Methoden-management Informationssysteme - Einkommensteuerpflicht Und Einkommensteuerveranlagung Im Kriege - Berichte Des Ausschusses Versuche Im Eisenbau - 50 Jahre Empirische Wahlforschung In Deutschland - Vergessen Sie Alles Ber Verkaufen - Kanzler Und Minister 2005 - 2013 - Modern Geometric Computing For Visualization - Handwrterbuch Zur Gesellschaft Deutschlands - The Psychology Of Expertise - Grundlagen Der Lebensmittelmikrobiologie - Praktische Baustatik - Atlas Normaler Rntgenbilder Des Schdels Atlas Of Normal Radiographs Of The Skull Atlas De Radiographies Normales Du Cr¢ne Atlas De Radiografias Normales Del Cr¡neo - „lieber Herr Fuchs Lieber Herr Schmatz! - Handbuch Der Frserei - Therapeutic Hemorheology - Essentials Of Ultrasonography - Solvency Ii And Risikomanagement - Feuerungsuntersuchungen Des Vereins Feuerungsbetrieb Und Rauchbekmpfung In Hamburg - Remote Sensing Of The Earth From Space Atmospheric Correction - Sicherheitspolitik In Lateinamerika - Digitalrichtfunk - Managementmaynahmen Gegen Produktpiraterie Und Industriespionage - Arterial Grafting For Myocardial Revascularization - Photonen - Stresses In Shells - The Silent Countdown - Griechische Staatsaltertmer - Handbuch Der Serodiagnose Der Syphilis - Stochastik Mit Mathematica - Pattern Recognition And Machine Learning - Neuordnung Oder Restauration - Transvaginal Colour Doppler - Physikalische Metallkunde - Ost-west-sprachgebrauch Zehn Jahre Nach Der Wende - Hip Biomechanics - Kritik Der Lebenswelt - Pulse Waves - Der Harnsure- Zystin- Xanthin-stein - Gefeuert Und Jetzt - Handbook Of Evidence-based Critical Care - Supervision Im Fokus - Einhrung In Die „protestantische Ethik Max Webers - Die Submikroskopische Anatomie Und Pathologie Der Lunge The Submicroscopic Anatomy And Pathology Of The Lung - Mutter Tochter Anne Kiz - Arzneistoffe - Journalismus Medien –ffentlichkeit - –ffentlich-private Partnerschaften - „ich Geh Ins Heim Und Komme Als Einstein Heraus - Production Systems And Supply Chain Management In Emerging Countries Best Practices - Projektierung Und Rationalisierung Von Kohlenbergwerken - Risiko Und Gesellschaft - Finanzausgleich Und Finanzbeziehungen Im Wiedervereinten Deutschland - Grundbau Dynamik - Generalisierte Lungenparenchymerkrankungen - Analysis Of Charge Transport - Praxishandbuch Corporate Magazines - Physiologie Und Pathophysiologie Der Atmung - Wege Zur Macht - Die Ausrstung Der Textilen Waren - Unartikulierte Krper - Das Einmaleins Der Siedlung - Paradigmenwechsel In Der Technologiepolitik - Planeten Wanderer Im All - Calcified Tissues 1965 - Das Traumatische Apallische Syndrom - Buchhrung Technik Und Praxis - Mandatsniederlegungen Auf Kommunaler Ebene - Die Harnrhren-gonorrhoe Des Mannes Und Ihre Komplikationen - Weck Den Sieger In Dir! - Gastric Anisakiasis In Japan - Dichtung Und Menschenkenntnis - Lehrbuch Der Speziellen Pathologie Und Therapie Der Inneren Krankheiten Studierende Und „rzte - Wrterbuch Der Kraftbertragungselemente Diccionario De Elementos De Transmisi³n Glossaire Dorganes De Transmission Glossary Of Transmission Elements Glossario Degli Organi Di Trasmissione Glossarium Voor Transmissie-organen Ordbok Fr Transmissionselement Voimansiirtoalan Sanakirja - Kreativitt Utopie Und Erziehung - Beitrge Zur Kenntnis Der Tsetsefliege Glossina Fusca Und Gl Tachinoides - Kommunikationswissenschaft Studieren - Qualittsmanagement In Der Assekuranz - New Trends In Computer Graphics - Elemente Der Mechanik Iv - Der Neuzeitliche Aufzug Mit Treibscheibenantrieb - Experimental Cardiovascular Diseases - Computational Mechanics 95 - Programm Zukunft - „rztliches Handbchlein Hygienisch-ditetische Hydrotherapeutische Mechanische Und Andere Verordnungen - Organizational Ambidexterity - Stress And Tension Control 3 - Italien Und Die Italiener - Streitfall Natur - Energetics Of Geological Processes - Sensoren Die Prozess- Und Fabrikautomation - Abstrakte Modellierung Digitaler Schaltungen - Publikumsforschung - Techniken Und Methoden Der Modernen Medizin - Stabilitt Im Umbruch - Finanzierung Der Betriebe - Grundzge Der Zhlertechnik - Anorganische Strukturchemie - Pestizide Und Umweltschutz - Abschied Von Der Aufklrung - Abhandlungen Aus Dem Aerodynamischen Institut An Der Technischen Hochschule Aachen - Das Gebiss Des Menschen Und Der Anthropomorphen Vergleichend-anatomische Untersuchungen - Steuerliche Wahlrechte - Dictionary For The Glass Industry Fachwrterbuch Die Glasindustrie - Computersicherheit - Ethical Issues Of Molecular Genetics In Psychiatry - Pro C 50 And The Net 45 Framework - Olaf Kind Ohne Sprache - Demokratie Und Entwicklung - Phraseologie In Der Politischen Rede - Early Papers On Diffraction Of X-rays By Crystals - Hochleistungskessel - Metaphysik Skepsis Wissenschaft - Histochemie - Neuropsychopharmacology - Prfungstrainer Mathematik - Integrierte Industrielle Sach- Und Dienstleistungen - Betrieb Und Anwendung Von Leistungs- Und Regeltransformatoren - Lost Brands - Vom Aufstieg Und Niedergang Starker Marken - Programmieren In C++ Borland-versionen - Schnittanatomie Des Menschlichen Gehirns - Basic Notes In Psychiatry - Chemische Analysen Mit Dem Polarographen - Gouvernementalitt Und Biopolitik - Kritik Als Qualittskriterium Pdagogischen Handelns - Molecular Neurobiology Of The Mammalian Brain - Fouriertransformation Fuygnger - Einhrung In Die Komplexe Behandlung Von Wechselstromaufgaben - Tunnelbaugeologie - Umweltgerechter Verkehr - Bildungspolitik Und Leistungsvergleichsstudien - Rechtssoziologie - Der Deutsche Bund Oder Ob Gotha Ob Bamberg - Kommunalpolitik - Kommunikation Und Differenz - Trennung Von Molekularen Mischungen Mit Hilfe Synthetischer Membranen - Erfolg Durch Resonanz - Das Restrisiko Gegenwrtiger Geburtshilfe - Bedarfsorientierte Kinderbetreuung - Elektrische Industriefen Weiterverarbeitung - Human Resources Management In Banken - Design For Environment As A Tool For The Development Of A Sustainable Supply Chain - Theorie Der Sozialen Gruppe - Der Getreideterminhandel In Deutschland Vor Und Seit Der Reichsbrsengesetzgebung - Elektronengerte - The Design Productivity Debate - Dermatologie - Bestnde-controlling - Testmanagement Bei Sap-projekten - Assembler Griffbereit - Betriebliche Rationalisierung Und Konomische Rationalitt - Strahlenschutz An Beschleunigern - Das Wealth-management-team In Der Kundenbetreuung - Genetic Effects Of Air Pollutants In Forest Tree Populations - Die Knochenbrche Und Ihre Behandlung - Roloffmatek Maschinenelemente - Auge Brille Auto - Recht Und Tabu - Perspektiven Mobiler Kommunikation - Verstndliche Wissenschaft - Individuelle Und Kulturelle Altersbilder - Vorrichtungsbau - Motor Neuron Disease - Atlas Anatomischer Varianten Des Schdels Im Rntgenbild - Basic Principles Of Knee Arthroscopy - Metallurgische Elektrochemie - Stoffliche Nutzung Nachwachsender Rohstoffe - Biologie Des Menschen - Die Araber Im 21 Jahrhundert - Management Von Innovation Und Wachstum - Die Transformation Ostdeutschlands - Klinische Endokrinologie - Versuch Einer Ontologie Der Persnlichkeit - Recht Im Bereitschaftsdienst - Einhrung In Das Einheitliche Wechselrecht - „sthetik Im Prozey - Ultrafast Mri - Contemporary Research On Renal Cell Carcinoma - Linguistik Im Internet - Das Bleichen Der Pflanzenfasern - Blutkrperchensenkung - Handbuch Der Schutzimpfungen - Die Chirurgie Des Mensurbodens - Allgemeine Chirurgie Vorgetragen In Frage Und Antwort Nebst Einigen Kapiteln Ber Frakturen Luxationen Und Hernien - Was Top-verkufer Auszeichnet - Handbuch Europischer Kapitalmarkt - Wie Aus Wildnis Gesellschaft Wird - Neurologische Differentialdiagnose - Praxishandbuch Presse- Und –ffentlichkeitsarbeit - Progress In Precision Engineering - Photon-vegetation Interactions - Klima Und Gradtage In Ihren Beziehungen Zur Heiz- Und Lftungstechnik - Shock Waves @ Marseille Iv - –kosystemforschung Der Rhein Und Seine Auen - Adjustment Of Schizophrenics In The Community - Handbuch Der Internationalen Politik - Einhrung In Die Physik - Entwerfen Und Herstellen - Preismodelle Deutscher Banken Im Privatkundengeschft - Die Kche Im Wohnerlebnis Der Deutschen - Die Bundesrepublik In Den Achtziger Jahren - Die Hieroglyphen Der Inneren Welt - Jahresabschluyprfung Der Kapitalgesellschaften - Entwicklungspsychologie Des Jugendalters - Peter Weiss Jahrbuch 2 - Diagnostic Imaging Of The Ear - Die Grundlagen Des Technischen Denkens Und Der Technischen Wissenschaft - Zwischen Wirtschaftstheorie Und Wirtschaftspolitik - Die Wirkung Verbaler Und Nonverbaler Kommunikation In Tv-duellen - Soziales Im Netz - Ihr Kopf Ihr Kapital - Dimensional Analysis And Scale-up In Chemical Engineering - Lehrbuch Der Mathematik Wirtschaftswissenschaften - Evolution Der Sprache Und Vernunft - Gewerbestaub Und Lungentuberkulose Stahl- Porzellan- Kohle- Kalkstaub Und Ruy Eine Literarische Und Experimentelle Studie - Erziehungs- Und Bildungspartnerschaften - Differenzierung Und Integration Der Modernen Gesellschaft - Chemical And Physical Behavior Of Human Hair - Ultraschalldiagnostik 90 - Jenseits Des Films - Stadt Und Soziale Ungleichheit - Rasse Und Ethnizitt - Gehirn Und Rckenmark - Oestrogene Beim Menschen - Militr Als Gegenkultur - Die Wissenschaftlichen Grundlagen Des Rundfunkempfangs - Browirtschaft - Die Genfer Scheckrechtsabkommen - Devianz - Krankheit Konflikt Und Soziale Kontrolle - Theorie Der Public Relations - Percutaneous Lumbar Discectomy - Abfallentsorgung Im Ausland - Experimentelle Beitrge Zu Einer Theorie Der Entwicklung - Demokratien In Europa - Finanzmrkte Nach Dem Flchenbrand - Surgical Ophthalmology - Bernhard Schwalbe Gedchtnisrede - Grundzge Der Geschichte Und Wirtschaft Der Kniglichen Oberfrsterei Eberswalde - Future Value - Aachener Bausachverstndigentage 2011 - Anleitung In Der Galvanischen Und Faradischen Behandlung - Urologische Endokrinologie - Readings In Multiple Criteria Decision Aid - Bodenbewirtschaftung Dngung Und Rekultivierung - Die Rechtssichere Abmahnung - Reinheit Des Rechts - Mglichkeiten Und Grenzen Der Frderung Verantwortlichen Handelns Von Wirtschaftsprfern In Moralisch Relevanten Situationen - Zukunftsgenese - Krper Sport Und Religion - Analysis Technische Oberschulen - Mehr Umsatz Mit Kaltakquise Und Direktbesuch - Die Gescheiterte Zukunft Der Ersten Republik - Heidelberg Congress On Taxing Consumption - Die Seminarien Volksschullehrer - Software-entwurf In Pearl-orientierter Form - Computergrafik Und Bildverarbeitung - Die Gasturbine - Handbook Of Parathyroid Diseases - Soziologische Aufklrung 4 - Klinische Konstitutionslehre - Beobachtungen Der Moderne - Geldanlage Mit Optionsscheinen - Multiple Criteria Decision Support In Engineering Design - Kabeltechnik - Font Technology - Medien Kinder - Digitales Fernsehen In Deutschland - Die Graphische Behandlung Der Mechanischen Wrmetheorie - Transgenic Mice And Mutants In Mhc Research - Informationslogistik - Akademische Lehrsttten Und Lehrer Der Oto-rhino-laryngologie In Deutschland Im 20 Jahrhundert - Altern „uyere Realitt Innere Wirklichkeiten - Stadtentwicklung Mit Stadtmanagement - Das Forschungsprojekt - Grundkurs Socketprogrammierung Mit C Unter Linux - Single-channel Recording - Gewerkschaftliche Jugendpolitik Zwischen Hbv Und Verdi - Perspektiven Der Medienkritik - Elemente Nachrichtentechnischer Systeme - Dynamik Der Mechanismen - Zur Geschichte Der Endokrinologie Und Reproduktionsmedizin - Der Fernsprechverkehr Als Massenerscheinung Mit Starken Schwankungen - Elektrotechnik Architekten Bauingenieure Und Gebudetechniker - Die Hartzerkleinerung - Inflation Und Geldentwertung - The Knee And The Cruciate Ligaments - The New World Of Economics - Die Politischen Theorien Der Gegenwart - Infrastructure And The Space-economy - Vascular Diagnostics - Der Haushaltsausschuy Des Deutschen Bundestages - Politik Und Rhetorik - Journalistische Kultur - Epidemiology And Management Of Root Diseases - The Radiotherapy Of Malignant Disease - Light Scattering In Solids - Formulieren Und Korrespondieren Im Beruf - Elektrotechnikelektronik Maschinenbauer - Das Recht Zur Qualitt - Mri In Der Gynkologie Und Geburtshilfe - Wissenssoziologie Sozialer Probleme - Schulwissen Mathematik Ein œberblick - E-shopping - Unix-werkzeuge - Timssiii Dritte Internationale Mathematik- Und Naturwissenschaftsstudie Mathematische Und Naturwissenschaftliche Bildung Am Ende Der Schullaufbahn - Analytische Und Numerische Methoden Der Feldberechnung - Reproductive Biology And Plant Breeding - Voices Of Resilience - New Methods Of Thought And Procedure - Politische Strategieanalyse - Taxation Of European Companies At The Time Of Establishment And Restructuring - Manipulatorpraxis - Von Der Naturforschung Zur Naturwissenschaft - Urological Emergencies In Clinical Practice - Diseases Of The Esophagus - Access To B-isdn Via Pons - European Solar Radiation Atlas - Lokale Beschftigung Und –konomie - Wissensspeicher Tribotechnik - Bausteine Des Chaos Fraktale - Lehren Und Lernen An Der Internationalen Frauenuniversitt - Demokratietheorie Und Politische Institutionen - Betriebsverrechnung In Der Chemischen Groyindustrie - Das Konzept Der Solidaritt - Erfolgsfaktor Vertrauen - Computerstile - Friedensprozess Im Nahen Osten - Kosss Cytology Of The Urinary Tract With Histopathologic Correlations - Die Ablsung Und Regelung Der Waldgrundgerechtigkeiten - Umweltbewusstsein Im Wandel - Kurt Hahn - Light Scattering Spectra Of Solids - Lernkompetenzen An Hochschulen Frdern - Technology-rating - Chemie Der Heterocyclen - Das Gewinner-prinzip - Das 1 — 1 Erfolgreicher Verkufer - Autonome Innervation Des Herzens Myokardiale Hypoxie - Magnetic Resonance And Related Phenomena - Zwischen Palaver Und Diskurs - Grundfragen Deutscher Wirtschaftspolitik - Wrme- Und Stofbergang In Strmungen - Lean Production - Kunst Und Religion Der Mayavlker - Chiral Separations - Biologie Im œberblick - The Biokinetics Of Flying And Swimming - Die Serse Entzndung - Kurze Chirurgische Operationslehre - Das Prfungsbuch - Schutz Als Neue Norm In Den Internationalen Beziehungen - Steps To Compliance With International Labour Standards - A Course In Complex Analysis - Handbuch Frhkindliche Bildungsforschung - Demokratie Eine Kultur Des Westens - Die Zerspanbarkeit Der Metallischen Und Nichtmetallischen Werkstoffe - Soziale Determinanten Des Drogengebrauchs - Postsozialistische Religion - Textproduktion Im Dialog - Talentmanagement Mit System - Fundamental Techniques In Pulmonary And Oesophageal Surgery - Biomedizinische Technik 4 - Sicherheit In Freiheit - Net Value - Postscript Level 2 Griffbereit - Die Polizei Des Bundes In Der Rechtsstaatlichen Pluralistischen Demokratie - Bauauftrge Erfolgreich Akquirieren - Stromrichter-netzrckwirkungen Und Ihre Beherrschung - A Dictionary Of Real Numbers - Textformulierung Sekretrinnen - Anleitung Zum Mischen Von Branntweinen Nach Maay Und Gewicht - Wieder Den Konomischen Unsinn! - Klinische Anatomie Des Ohres - Germinal Centers In Immune Responses - Der Kaspar-hauser-effekt - Die Pflanzliche Zellwand - Wrterbuch Der Marxistisch-leninistischen Soziologie - Clinical Facial Analysis - Metropolitan Governance In Deutschland - Recursive Block Coding For Image Data Compression - Politikwissenschaft Als Kulturwissenschaft - Advances In Data Base Theory - Die Theorie Sozialer Schlieyung - Mechanisms Of Chromospheric And Coronal Heating - Forum Qualitative Schulforschung 2 - Die Literarische Moderne In Europa - Vom Ordoliberalismus Zur Sozialen Marktwirtschaft - Migrne - Multidisciplinary Management Of Rectal Cancer - Erklrungsnotstand Altersvorsorge - Allgemeine Physiologie - Elektronische Demokratie Und Virtuelles Regieren - Wieder Das Fusionsfieber - Geschichte Des Deutsch-franzsischen Krieges 1870 Und 1871 - Interviews In Der Recherche - Controller-anforderungsprofile - Das Sterreichische Bergschadenrecht Unter Bercksichtigung Des Deutschen Bergrechtes - The Contextual Challenges Of Occupational Sex Segregation - Die Entropie-diagramme Der Verbrennungsmotoren Einschlieylich Der Gasturbine - Towards An Ecologically Sustainable Growth Society - Tron Project 1988 - 300 Jahre Deutsch-japanische Beziehungen In Der Medizin - Hautkrankheiten Und Syphilis Im Suglings Und Kindesalter - Moderne Geriatrie Und Akutmedizin - Innovation In Esophageal Surgery - Lehrbuch Der Chirurgie Und Orthopdie Des Kindesalters - Optimization And Performance Analysis Of High Speed Mobile Access Networks - Berechnung Von Verbundkonstruktionen Aus Stahl Und Beton - 9 Kongrey Der Deutschsprachigen Gesellschaft Intraokularlinsen Implantation - Tmlr Management Of Coronary Artery Diseases - Einhrung In Die Staatslehre - Der Deutsche Bundestag Im Wandel - Die Vereinfachte Berechnung Biegsamer Platten - Individuum Und Krankheit - Tunnelbau - Allgemeine Wirtschaftslehre Industriekaufleute - Die Psychologie Des Verbrechens - 23 Deutscher Soziologentag 1986 - Demokratie Und Technik Keine Wahlverwandtschaft - Die Berechnung Von Rotierenden Scheiben Und Schalen - Mr Mammography Mrm - Staat Und Globalisierung - Diagnostic Imaging Of The Nose And Paranasal Sinuses - Die Schleimhute Des Ohres Und Der Luftwege - Leitfaden Das Maschinenzeichnen - Bakterielle Erkrankungen Der Kulturpflanzen - Clientserver-technologie In Der Unternehmenspraxis - Nation Und Modernitt Als Mythen - Langzeitverlufe Und Sptresultate Bei Querschnittlhmung - Peripheral Blood Stem Cell Autografts - Das Informierte Management - Methoden Zur Bestimmung Pflanzlicher Wuchsstoffe - In-patient Treatment For Alcoholism - Akteure Beim Bodenschutz - Pouch - Georg Von Siemens Ein Lebensbild Aus Deutschlands Groyer Zeit - Das Herz Und Die Blutgefye - Die Kohlenoxydvergiftung - Das Wirtschaftssystem Fords - Youth And Housing In Germany And The European Union - Lebenshrung Und Gesellschaft - Arrhythmiebehandlung Und Hmodynamik - Grundriy Der Unfallneurologie - Arends Volkstmliche Namen Der Drogen Heilkruter Arzneimittel Und Chemikalien - Kompetenz Und Kultur - Politische Bildung Und Geschlechterverhltnis - Schub Und Torsion In Geraden Stben - Erfolgsstrategien Zulieferer - Pharmazeutische Informationssysteme - Olfaction And Odours - Visuelle Kommunikationsforschung - Neutron Physics - Aus Der Werkstatt Der Psychoanalytiker - Handbuch Organisationstypen - Mikrosystemtechnik Auf Silizium - Petri-netze - Der Pauli-jung-dialog Und Seine Bedeutung Die Moderne Wissenschaft - Lineare Algebra Und Analytische Geometrie I - Das Werk Heinrich Blls - Intelligent Transportation And Evacuation Planning - Methoden Der Textanalyse - Wahl-kampf Um Europa - Basiswissen Investition Und Finanzierung - Die Arbeiterverhltnisse In Der Forstwirthschaft Des Staates - Prozeymanagement Mit System - Allgemeine Physikalische Und Klinische Untersuchungen - Fremden Feindlichkeit - Gammopathy - Renaturierung Nach Dem Braunkohleabbau - Die Hormone Ihre Physiologie Und Pharmakologie - Die Fabrikation Der Bleichmaterialien - Professionelles Zeitmanagement - Lehrbuch Der Mikrochemie - Die Transformation Kulturellen Kapitals - Das Billionen-dollar-unternehmen - Medical Applications Of Microcomputers - Brain Behaviour And Iron In The Infant Diet - Recent Advances In Management Of Digestive Cancers - Nuclear Freeze Campaign - Politik Und Nichtpolitik - Fotochemikalien - Aufwachsen Und Lernen In Der Sozialen Stadt - Einhrung In Die Theorie Der Schwachstromtechnik - Gewalt Und Fremdenfeindlichkeit Jugendpdagogische Auswege - Korrosion Passivitt Und Oberflchenschutz Von Metallen - Pathologische Histologie - Implant Bone Interface - Die Dampfturbinen - Veins - Atlas Of Endoscopic Perforator Vein Surgery - Kanle Gottes - Betriebskosten Der Verschiebebahnhfe - Die Person Als Organon In Der Sozialen Arbeit - Die Metallischen Werkstoffe Des Maschinenbaues - Das Objekt-paradigma In Der Informatik - Fahrdynamik Des Schienenverkehrs - Weltunternehmen Und Historische Formen Des Unternehmens - Eu-beitritt Verheiyung Oder Bedrohung - Der Demokratische Verfassungsstaat - Aktie Im Aufwind - Die Parkinsonsche Krankheit Und Ihre Behandlung - Die Widerstandsfhigkeit Von Dampfkesselwandungen - Der Liquor - Demokratie Nach Dem Ende Des Kommunismus - Spinal Cord Monitoring And Electrodiagnosis - Neue Soziale Risiken Und Soziale Arbeit In Der Transformationsgesellschaft - Geschftsprozesse Realisieren - Im Lande Der Aufgehenden Sonne - Die Wassermannsche Reaktion In Ihrer Serologischen Technik Und Klinischen Bedeutung Auf Grund Von Untersuchungen Und Erfahrungen In Der Chirurgie - Plastische Chirurgie Am Auge - Teilhabe An Der Gesellschaft - Pdagogische Permissivitt - Krise Und Zukunft Des Sozialstaates - Querschlger - Informations- Und Kodierungstheorie - Vorteilhaftigkeit Zwischen Leasing Und Kreditfinanziertem Kauf - Kreative Industrien - Arbeit Im Ruhestand - Physiologie Und Funktion Von Pflanzenwurzeln - Recycling Von Elektro- Und Elektronikschrott - Analysis - Individualisierung - Perspektivenbernahme - Bcg-therapie Des Oberflchlichen Harnblasenkarzinoms - Metallfachrechnen 5 - Jg=tafel Luft Und Verbrennungsgase - Grundlagen Und Methoden Der Periodenforschung - Stadtgesellschaft Und Kindheit Im Prozey Der Zivilisation - Der Deutsche Frauenrat - Amerikanische Wirtschaftspolitik - Umwelt Global - Soziale Lagen Im œbergang - Heimat In Zeiten Erhhter Flexibilittsanforderungen - Gottfried Benn - Genetics Of Fungi - Legasthenie - Das Heartbeat-modell - Die Grundbuchsachen In Der Gerichtlichen Praxis - Isolierte Partner - Der Moderne Dandy - Parlamentarismus Im Zeitalter Der Europischen Integration - Welche Zukunft Den Sozialstaat - Ajcc Cancer Staging Atlas - Rauschen - Schulforschung Fallanalyse Lehrerbildung - Nlp Im Business - Ohne C Zu C++ - Masterkurs Parallele Und Verteilte Systeme - „der Rckblick Auf Die Vergangenheit Wird Sich Nicht Vermeiden Lassen - Prmierung Des Friedens - Pulstechnik - Gustav Adolf Hirn Sein Leben Und Seine Werke - Arbeitsbltter Friseure 3 - Frankreich-jahrbuch 1991 - Die Feldschwchung Bei Bahnmotoren - Gatt Und Neue Welthandelsordnung - Lokale Publizistik - Stochastische Signale - Kausalmodelle Zur Lieferantenbewertung - Standardisierung Der Bildung - Kommentar Zur Wrmeschutzverordnung 1995 - Urinary Enzymes - Epidemiology Of Prostate Disease - Therapy Of Malignant Brain Tumors - Das Problem Der Entwicklung Unseres Planetensystems - Entwickelungsgeschichtliche Untersuchung Ber Crenothrix Polyspora Die Ursache Der Berliner Wassercalamitt - Grundlagen Der Steuerlehre - Formeln Und Tabellen Stahlbau - Ermittlung Der Billigsten Betriebskraft Fabriken - Participatory Governance In Multi-level Context - Europische Integration - Content Management Integrierter Medienprodukte - Analytische Erkenntnistheorie - Die Befragung Im Kontext Von Raum Zeit Und Befindlichkeit - Dust Explosions - Mindfulness And Acceptance In Couple And Family Therapy - Konsumentenheterogenitt Und Struktur Des Auyenhandels - Goethes Naturwissenschaftliches Denken Und Wirken - Mdchenfreundschaften In Der Adoleszenz - Technischer Ausbau Von Gebuden - Cognitive Psychotherapy - Intersectionality Und Kritik - Principles And Management Of Adrenal Cancer - Die Prognose Chronischer Erkrankungen Long-term Observations Of Chronic Diseases - Konfliktmanagement Bei Groupware - Soziologie Und Sozialgeschichte - Handbuch Abfall Wirtschaft Und Recycling - Alterssicherung Von Frauen - –konomie Als Grundlage Politischer Entscheidungen - Microcomputers In Medicine - 11 Irrtmer Ber Social Media - Die Mercerisierungsverfahren - Meteorologie Der Strahlstrme - Menschen Machen Wirtschaft - Knstliche Radioaktive Isotope In Physiologie Diagnostik Und Therapieradioactive Isotopes In Physiology Diagnostics And Therapy - Metallische Implantate In Der Knochenchirurgie - Philosophieren Mit Kindern - Nutzerakzeptanz Von Webbasierten Anwendungen - Kulturmanagement Ii - Dtp-praxis Mit Pagemaker 5 - Leben Und Arbeit - Technischer Lehrgang Ventile - Umweltorientierte Marktwirtschaft - Handbook Of Neurochemistry - Informatik Und Mathematik - Kapitalstrukturpolitik Deutscher Brsennotierter Aktiengesellschaften - Tron Project 1989 - Peptides - Bodenkologie Mikrobiologie Und Bodenenzymatik Band I - Studium Nach Bologna Praxisbezge Strken! - Vibration Of Buildings To Wind And Earthquake Loads - Computer Und Weltbild - Konservative Revolution Und Neue Rechte - Regiomontanus - Wahlfreiheit In Der Fernsehnutzung - Wieviel Management Braucht Der Mensch - Transformationsprobleme In Ostdeutschland - Der Verkauf Elektrischer Arbeit - Elternkurse Auf Dem Prfstand - Diagnostik Und Therapie Der Pulpakrankheiten - Regieren Und Intergouvernementale Beziehungen - Die Organisation Der Parteien In Russland - Europawahl 2004 - A Therapist Manual For Cognitive Behavior Therapy In Groups - Geld Und Geschlecht - Diagnostic Interviewing - Durchwurzelung Rhizodeposition Und Pflanzenvergbarkeit Von Nhrstoffen Und Schwermetallen - Microsurgery Of The Temporo-medial Region - Medienrezeption - Jugend Politik Und Politische Bildung - Static Electrification - Vom Medienkind Zum Kinderstar - Bildung Neu Denken! Das Zukunftsprojekt - Formale Semantik Und Natrliche Sprache - Personalauswahl Ii - A Second Generation Pacs Concept - Geldanlage Gewinner Trotz Krise Profitieren - Pdagogik Die Kinder Stark Macht - Das Tuberkuloseproblem - Nonlinear Finite Element Analysis In Structural Mechanics - Der Verkappte Einheitsstaat - Bemessungstafeln Eisenbetonkonstruktionen - Die Wichtigsten Krankheiten Des Kaninchens - Afrika Jahrbuch 2002 - Argumenta Papiniani - Psychiatrie In Der Literatur - Immediate-early Genes In The Central Nervous System - Leitfaden Der Technischen Wrmemechanik - Soziologische Stichworte - Sexuelle Traumatisierung Und Ihre Folgen - Audiovisuelle Medienberufe - Mechanik Deformierbarer Krper - Coronary Artery Graft Disease - Sachsen-anhalt In Europa Europa In Sachsen-anhalt - Kulturvergleichende Psychologie - Durch Die Usa Und Canada Im Jahre 1887 - Medizinische Psychologie „rzte Und Psychologen - Buchhrung Reiseverkehrskaufleute - „als Der Geist Der Gemeinschaft Eine Sprache Fand - Belastung Und Beanspruchung Im Lehrerberuf - Umweltbetriebsprfung Und –ko-auditing - Soziologische Theorie Und Empirie - Krankenernhrung - Logistikprozesse Mit Sap R3 - Internationales Handbuch Der Gewaltforschung - Prekrer œbergang In Den Ruhestand - Zwischen Drinnen Und Drauyen - Entwurf Analoger Und Digitaler Filter - Randwertprobleme Der Mikrowellenphysik - Spektrale Zuordnungstafel Der Infrarot-absorptionsbanden - Die Arenen-integration Nationaler –ffentlichkeiten - Secondary Algebra Education Revisiting Topics And Themes And Exploring The Unknown - Umweltbewuytsein Und Alltagshandeln - Atlas Der Farbdopplerechokardiographie - Der Wrmeaustausch Im Festen Erdboden In Gewssern Und In Der Atmosphre - Regionale Analyse Mit Kleinen Gebietseinheiten - Troubleshooting Oracle Performance - Asymptotic Modeling Of Atmospheric Flows - Die Gesellschaftliche „natur Der Technik - Eliten In Deutschland - Reform Of Higher Education In Europe - Blattern Und Schutzpockenimpfung - Politische Theorie - Virus- Und Rickettsieninfektionen Des Menschen - Gynkologie Und Geburtshilfe 1992 - Die Entwicklung Ihres Unternehmens - Pornografie An Kindern - Die Vorteilhaftigkeit Relativer Anreizschemata Unter Bercksichtigung Der Kollusionsgefahr - Stahl- Und Verbundkonstruktionen - Masterkurs Kostenstellenrechnung Mit Sap - Neuropsychologie - Die Diagnose Des Kleinen Magenkrebses - Empirisch Begrndete Typenbildung - 100 Grafik-rezepte Turbo Pascal Unter Windows - Das Politische System Der Bundesrepublik Deutschland Im Kontext - Probleme Aus Der Physik - Die Aktive Auyen- Und Sicherheitspolitik Der Rot-grnen Bundesregierung 1998-2005 - Staatsoberhupter In Westlichen Demokratien - Internationale Anlagengeschfte - Absolute Thermische Daten Und Gleichgewichtskonstante - Medienstadt - Topics On Nonlinear Wave-plasma Interaction - Advances In Meat Research - Sende- Und Empfangsdioden Die Optische Nachrichtentechnik - Vorlesungen Ber Numerische Mathematik - Party-voter Linkage In Africa - Fachkommentar Bm„e-go - Institutionelle Herausforderungen Im Neuen Europa - Das Prinzip Mtterlichkeit - Geschlechterbergreifende Soziale Ressource - Ressourcenorientiert Arbeiten - Atlas Der Pathologie Urologischer Tumoren - Rohrleitungs- Und Apparatebau - Bone Marrow And Bone Tissue - Die Ffentliche Begrndung Politischen Handelns - Lagermetalle Und Ihre Technologische Bewertung - Therapeutic Antibodies - Die Fdp - Scheduling In Computer And Manufacturing Systems - Ultradian Rhythms In Life Processes - Das Verbrechen Iii - Sprachspiel Metapher - Diversity In European Marketing - Angewandte Statistik Mit Spss - Air Navigation Law - Campylobacter Pylori - Funktionentheorie Differentialtopologie Und Singularitten - Geschichte Der Politischen Ideen - Die Chromgerbung - Von Der Fachschule In Die Hochschule - Die Neue Arbeitsgerichtsbarkeit - Handbuch Zur Gleichstellungspolitik An Hochschulen - Raumbildung Bildungsrume - Leitfaden Der Werkzeugmaschinenkunde - Die Trocknung Und Entwsserung Von Kohle - Atlas Of Atherosclerosis - Innovationen In Einrichtungen Der Familienbildung - Flexible Plankostenrechnung Und Deckungsbeitragsrechnung - Negative Versus Positive Schizophrenia - Kommentar Zu Dem Gesetz Ber Den Verkehr Mit Betubungsmitteln Opiumgesetz Und Seinen Aushrungsbestimmungen - Analyse Der Fette Und Wachse Sowie Der Erzeugnisse Der Fettindustrie - Weltkultur Und Weltgesellschaft - Schreiben - Alles Was Sie Ber Marken Wissen Mssen - Dasselbe Noch Einmal Die „sthetik Der Wiederholung - Distributed Environments - Jungquartre Landschaftsrume - Gleichstellungsorientierte Arbeit Mit Mdchen Und Jungen Frauen - Defekte Demokratie - Macht Der Unschuld - Geschlechterdifferenzierungen Im Horizont Der Gleichheit - Nation Und Nationale Identitt - Lehrbuch Der Nasen- Und Hals Heilkunde Und Der Endoskopie Der Speiserhre Und Der Luftwege - Die Nierenfunktionsprfungen Im Dienst Der Chirurgie - Stadtteilmanagement - Beschftigungsrisiko Erziehungsurlaub - Innovatives It-management - Die Heizerschule - Demokratietheorie Und Demokratieentwicklung - Anker Und Ankerungen Zur Stabilisierung Des Gebirges - Kriminalitt - Using Technology To Sell - Frequency Standards And Metrology - Carl Schmitt Und Die Liberalismuskritik - Intensive Elektronen- Und Ionenstrahlen - Weltordnung Durch Us-leadership - Betriebskosten Und Organisation Im Baumaschinenwesen - Medienalltag - Perforierende Keratoplastik - Technik Und Demokratie - Dienstleistungs-management - Fertigungsvorbereitung Als Grundlage Der Arbeitsvorbereitung - Pharmazeutische Technologie - Die Gedanken Werden Handgreiflich - Hrung Neu Verorten - Practical Common Lisp - –kologie Und Urbane Lebensweise - Ursprnge Der Zweiten Republik - Querdenken Im Marketing - Fertigungstechnik Von Luft- Und Raumfahrzeugen - Individuelle Freiheit Zum Wohle Aller - Biographieforschung Und Kulturanalyse - Plastic Surgery In The Sexually Handicapped - Zuwanderungspolitik Im Nationalstaat - Random Signals And Processes Primer With Matlab - Streitbare Demokratie Und Innere Sicherheit - Unternehmensfinanzierung - Ausbildungskompass Steuerfachangestellte - Wahlen Und Politikvermittlung Durch Massenmedien - Die Volkswirtschaftliche Bilanz Und Eine Neue Theorie Der Wechselkurse - Die Missbildungen Und Anomalien Der Nase Und Des Nasenrachenraumes - Software-prfung - Dampfturbinen-verbrauchsdiagramme - Handbuch Offene Kinder- Und Jugendarbeit - Jugendliche Angestellte - Katheterablation Supraventrikulrer Tachykardien - Robotersysteme 1 - Die Prinzipien Der Lebensversicherungstechnik - Bildungsidentitt - Funktionentheorie Und Ihre Anwendung In Der Technik - Quality Control In Endoscopy - Psychische Strungen Im Kindes- Und Jugendalter - Berechnung Von Rahmenkonstruktionen Und Statisch Unbestimmten Systemen Des Eisen- Und Eisenbetonbaues - Mhc + X - Schaltungen Der Datenverarbeitung - Introduction To Earth And Planetary System Science - Altersbilder Und Altenhilfe - Recurrent Mood Disorders - Degenerative Gefyerkrankungen - Strmungsfrderer - Surgery Of Vertebrobasilar Aneurysms - Die Patentrecherche - Die Schleifmaschine In Der Metallbearbeitung - Advances In Nitrate Therapy - Rubber Technology - Beginning Db2 - Eisenbahn-balkenbrcken - Jugendsprache - Wrter In Der Politik - Medienmanagement - Symmetrische Verschlsselungsverfahren - Alte Menschen In Ihrer Umwelt - Numerical Algorithms With Fortran - Handbuch Sozialraum - Dielektrisches Material - Urbane Soziale Brennpunkte Exklusion Und Soziale Hilfe - Amerikanische Und Deutsche Groydampfkessel - Digitale Signalverarbeitung Mit Matlab - Alzheimer Disease - Proceedings Of The First Lunar International Laboratory Lil Symposium Research In Geosciences And Astronomy - Sediments And Environmental Geochemistry - Klinische Rntgendiagnostik Chirurgischer Erkrankungen - The Risk Analysis Controversy - Soziales Vertrauen - Untersuchungstechniken In Der Echokardiographie - Assisted Circulation 3 - Therapie Der Angina Pectoris Mit Teopranitol - Der Einfluy Der Rckgewinnbaren Yerlustwrme Des Hochdruckteils Auf Den Dampfverbrauch Der Dampf-turbinen - C++ Programmierer - Terrigenous Mass Movements - Briefe - Holografie - Der Konstitutionstypus Als Genetisches Problem - Rationelle Energieverwendung Im Hochbau - Grundriss Der Dermatologie - Data Mining Im Personalmanagement - Geometry And Theoretical Physics - Elektrische Gasentladungslampen - Heart-brain Interactions - Die Dreielektrodenrhre Und Ihre Anwendung - The Mediastinum - Unverletzende Selbstbehauptung - Anleitungen Zum Arbeiten Im Rhrenlaboratorium - Ideen Zu Einer Reinen Phnomenologie Und Phnomenologischen Philosophie - Geschichte Der Medizinisch-biologischen Institute Berlin-buch - Sonographie Des Gastrointestinaltrakts - Formelsammlung Wirtschaftsmathematik - Allgemeine Elektrotechnik - Kultursoziologie - Einhrung In Die Politischen Theorien Der Gegenwart - Der Mnnliche Habitus - Charisma - Parteien Im Wandel - Aufwertung Der Erziehungsarbeit - Einhrung In Die Probleme Des Elektrischen Lichtbogen- Und Widerstandsofens - Optimale Industriestandorte - Fachrechnen Raumausstatter - Papierchromatographie In Der Botanik - Handbook Of Computational Solid Mechanics - Arbeitslosigkeit Und Wohlfahrtsstaat In Westeuropa - Leben In Benachteiligten Wohngebieten - Grundinformation Recht - Lehrbuch Der Hochbaukonstruktionen - Niederspannungs-leistungsschalter - Die Chemische Untersuchung Und Beurtheilung Des Weines - Current Practice Of Fracture Treatment - Ultrasound Of Appendicitis - Der Arzt Am Krankenbett - Turbo Pascal 70 - Deutsche Philosophie - Fern-sehen Im Alltag - Politik Und Regieren In Hessen - Italien - Lehrbuch Der Bergwirtschaft - Autonomes Handeln Als Personale Und Gesellschaftliche Aufgabe - Geboren 1964 Und 1971 - Ausgewhlte Schriften - Die Liberalen Parteien Angesichts Der Zukunft Preuyens - Umweltschutz Produktqualitt Und Unternehmenserfolg - Parteimitglieder - Die Kinematographische Kamera - Mediation Erforschen - Schule In Der Wissensgesellschaft - Unterricht Und Didaktik Der Politischen Bildung In Der Bundesrepublik - Host Defense Dysfunction In Trauma Shock And Sepsis - Mit Benchmarking An Die Spitze - Electron Spin Resonance Esr Applications In Organic And Bioorganic Materials - Elektrochemische Kinetik - Femorokrurale Arterienverschlsse - Basic And Clinical Research On Renal Cell Carcinoma - Plastics Processing Data Handbook - Lebertumoren Und Portale Hypertension - Atlas Der Hmatologischen Zytologie - Fachrechnen Metallberufe - Die Gesammte Lehre Der Waldstreu Mit Rcksicht Auf Die Chemische Statik Des Waldbaues Unter Zugrundlegung Der In Den Knigl Staatsforsten Bayerns Angestellten Untersuchungen - European Data Protection In Good Health - Lehrbuch Der Hypnose - Kommunikation In Der Organisation - Attributgrammatiken - Verhaltenskologie Der Technik - Die Lebensstilgesellschaft - Chromosomal Alterations - Arduino And Kinect Projects - Theorien Gesellschaftlicher Differenzierung - Positionen Der Psychiatrie - Starthilfe Bwl - Die Natrliche Verbreitung Der Lrche In Den Ostalpen - Exklusionsindividualitt - Autochthone Modernitt - Der Deutsche Bundestag - Scientific Visualization Of Physical Phenomena - Schulwesen Und Organisation - Der Entschlsselte Wachstumscode - Die Waldbautechnik Im Spessart - Festigkeitseigenschaften Und Gegebilder Der Konstruktionsmaterialien - Nitrates And Nitrate Tolerance In Angina Pectoris - Semiconductor Physics - Erbbiologie Und Erbpathologie Nervser Und Psychischer Zustnde Und Funktionen - Sexualitt Miybrauch Gewalt - Abschied Von Der Normalfamilie - Die Erziehungsanstalt Schnepfenthal 17841934 - Thermodynamic Data On Oxides And Silicates - Gradient Hplc Of Copolymers And Chromatographic Cross-fractionation - Surgery Of The Spine - Die Schmiermittel - Verfassungsrecht Und Verfassungswirklichkeit Im Vereinigten Deutschland - Bone Implant Grafting - Wege Zur Hochschulreife In Baden-wrttemberg - Mechanoreceptors - Soziologie Des Sports - Assembly Of Enveloped Rna Viruses - Religion Und Familienpolitik - Direct Democracy And Minorities - Grundlagen Der Bruchmechanik - Advances In Superconductivity Ii - Konfliktkompetenz - Die Chirurgische Behandlung Des Colon-carcinoms - Tragwerke Hochbauten - Sexuelle Gewalt Gegen Behinderte Menschen Und Das Recht - Kultur Als Prozess - Das Elite- Missverstndnis - Micturition - Minderjhrige Flchtlinge - 40 Jahre Kardiologie An Den Universittskliniken Des Saarlandeshomburg 1959 1999 - Unternehmensgrndung Und Dezentralitt - Innovationskompetenz In Unternehmen - Der Umbau Des Sozialstaates - Seelenleben Und Menschenbild - Ophthalmologische Ultraschalldiagnostik - Die Sozialen Aufgaben Der Arbeitgeber - Expressive Ungleichheit - Entwicklung Eingebetteter Systeme - Operationsverstrker - Parteisoldaten Und Rebellen - Atlas On The Biology Of Soil Arthropods - Die Behandlung Der Geschwlste Nach Dem Gegenwrtigen Stande Und Den Ergebnissen Der Experimentellen Forschung - Heilen Und Bilden - Die Wischendampfverwertung In Entwicklung Theorie Und Wirtschaftlichkeit - Einhrung In Die Mechanik Mit Einfachen Beispielen Aus Der Flugtechnik - Alternativer Umgang Mit Alternativen - Die Dynamik Organisierter Beschftigungsfrderung - Industrielle Keramik - Verschluss-sache Pkv - Der Frser Als Rechner - Turbulenzen Im Transformationsprozey - Ethikbasierte Unternehmenshrung Und Commitment Der Mitarbeiter - The Sages Manual On The Fundamental Use Of Surgical Energy Fuse - Tectonofractography - Geldanlage Und Steuer 1999 - Vertrauen Und Kooperation In Der Arbeitswelt - Hhere Mathematik Ingenieure - Kabel-herstellung - Engineering Mathematics - Windows Phone Recipes - Knstliche Intelligenz Und Heuristisches Programmieren - Die Rechenmaschinen Von Konrad Zuse - Die Bndel-nagelung Experimentelle Und Klinische Studie Ber Eine Neuartige Methode Der Markraum-schienung Langer Rhrenknochen - Fokus Und Balance - Menschen Maschinen Mrkte - Corrosion Of High-performance Ceramics - Der Beton - Zuverlssigkeits- Und Instandhaltungstheorie - Die Unspezifischen Bluteiweissreaktionen - Der Bau Des Dieselmotors - Stadt Und Kultur - Die Organisation Der Riesenstadt - Imaging Techniques In Orthopaedics - Nutritional Management Of Cancer Treatment Effects - œberlebensstrategien Hrungskrfte - Zirkulationsstrungen Des Gehirns Im Serienangiogramm - Allergic Contact Dermatitis - Praktische Mathematik Mit Matlab Scilab Und Octave - Pediatric Body Ct - Vorkurs Informatik - Risiko Kreditklemme - Frankreich-jahrbuch 1989 - Elemente Der Dritten Gruppe - Mind The Gap! - Intermolecular Forces - Zwischen Netzwerk Und Institution - Ditetik Innerer Erkrankungen - Die Natrliche Und Knstliche Alterung Des Gehrteten Stahles - Nicolaus Steno - Adapted Physical Activity - Kosovo - Medicinisch-klinische Diagnostik - –ffentlichkeit Als Prozey - Risikoorientierte Bauprojekt-kalkulation - Mechanisches Verhalten Der Werkstoffe - Immunoassays In Coagulation Testing - Radiobiology In Radiotherapy - Mathematische Grundlagen Der Hheren Geodsie Und Kartographie - Die Wanderwellenvorgnge Auf Experimenteller Grundlage - Vorsprung Durch Einmaligkeit - Geschftspartner S Leben - Umweltbelastungen Und „ngste - Management Komplexer Familienvermgen - Die Grundlagen Der Nomographie - Die Nomographie Oder Fluchtlinienkunst - Der Augenhintergrund Bei Allgemeinerkrankungen - Das Schmiedbare Eisen - Lehrbuch Der Chemischen Technologie Und Metallurgie - Microdosimetry And Its Applications - Benign Prostatic Hyperplasia - Analogcomputer In Chemie Und Biologie - Der Mensch Und Seine Medien - Hypnotismus Und Medizin - Der Gestaltete Lernkontext - Schulqualifikation Und Berufsfindung - Medien Und Transformation In Osteuropa - Die Blockierte Gesellschaft - Wege Zu Neuen Arzneimitteln - Vergleichen In Der Politikwissenschaft - Honorarpraxis Architekten Und Ingenieure Textsammlung - Management And More - Werte Und Kriminalitt - Grundriss Der Histologie Und Mikroskopischen Anatomie Des Menschen - Ingenieur Und Wirtschaft Der Wirtschafts-ingenieur - Modern Clinical Molecular Techniques - Mathematische Analyse Des Raumproblems - Pdagogik Der Massenkommunikation - Die Ermittlung Der Kegelrad-abmessungen - The Pyloric Sphincteric Cylinder In Health And Disease - Politische Steuerung Im Wandel Der Einfluss Von Ideen Und Problemstrukturen - Cervical Spine Ii - Exploration Of Halley Comet - Effektiv Starten Mit Turbo Pascal 60 - Molecular Geometry Of Body Pattern In Birds - E-mail-marketing - Identitt Und Interesse - Die Geschichte Der Frauenbewegung In Deutschland - Armutsforschung Und Sozialberichterstattung In Den Neuen Bundeslndern - Model Order Reduction Techniques With Applications In Electrical Engineering - Durch Luhmanns Brille - The Purchasing Chessboard - Das Seltsame Problem Der Weltgesellschaft - Principles Of Fluorescence Spectroscopy - Gegenbilder - Pacific Crystal Centre For Science Mathematics And Technology Literacy Lessons Learned - Heat Shock - Der Werdende Mensch - Inszenierungen Von Weiblichkeit - Leitfaden Der Anthropologie - Bauakustik - Rechtsextremismus Und Neue Rechte In Deutschland - Direkte Demokratie - Technikentwicklung Und Politische Bildung - Verdichtungsrume - Die Wirtschaftlichkeit Von Nebenproduktenanlagen Kraftwerke - Die Europische Union Nach Der Osterweiterung - Theoretical Geomorphology - Grundstze Ordnungsmyiger Verbindlichkeitsbilanzierung Arbeitsverhltnisse - Traumatic Hip Dislocation In Childhood - Ao-instrumente Und -implantate - The Ichthyoses - Atlas Der Pulmonalen Funktionsdiagnostik - Fault-tolerant Design - Wie Ich Pluto Zur Strecke Brachte - Management-philosophie - Vermgensverwaltung Mit Fondspicking - Handbuch Des Strayenbaus - Die Variabilitt Niederer Organismen - Einhrung In Die Geophysik Ii - Induktionsmaschinen - Talk Auf Allen Kanlen - Die Klinik Der Coronarerkrankungen - Ergebnisse Der Hygiene Bakteriologie Immunittsforschung Und Experimentellen Therapie - Deskriptive Statistik Und Moderne Datenanalyse - Winner Edge Konzepte Vorsprung - The Macula - Wurzelinduzierte Bodenvorgnge - Beginning Facebook Game Apps Development - Gabler Wirtschaftslexikon - Kaiser Wilhelm Sein Leben Und Seine Zeit 17971888 - Zeitgenssische Demokratietheorie - Vorsprung Durch Sympathie - Milieu Urbanitt Und Raum - Aktivposten Wissenskapital - Distributed Autonomous Robotic Systems 3 - Die Wirtschaftliche Entwicklung Der Beiden Staaten In Deutschland - Versicherungsbetrug Verstehen Und Verhindern - Einhrung In Die Statistik - Leitfaden Der Rundfunkentstrung - Markenpsychologie - Medienkriege - Information Management For Business And Competitive Intelligence And Excellence - Umwelt Beschftigung Und Zukunft Der Wachstumsgesellschaften - Macht Und Ohn-macht Im Management - Die Synthese Von Einheitlichen Polymeren - Das Rntgenbild Des Schdels Bei Intrakranieller Drucksteigerung Im Wachstumsalter - Friedensstrategien - Die Fichte In Bezug Auf Ertrag Zuwachs Und Form - Grundzge Der Botanik Pharmazeuten - Vorlesungen Ber Hhere Geometrie - Surgical Endodontics - Der Effiziente Staat Fiktion Oder Vision - Das Entwerfen Von Graphischen Rechentafeln - Mtterspiegel - Georg Luk¡cs - Nutrition Diet And Cancer - Weichteilrheumatismus Und Andere Schmerzsyndrome Des Bewegungsapparates - Elastizitt Und Festigkeit - Die Chemische Untersuchung Des Eisens - Peripherisierung Stigmatisierung Abhngigkeit - Der Fall Schwerte Im Kontext - Die Periphere Schmerzauslsung Und Schmerzausschaltung - Der Jugoslawien-krieg - Symbol Und Soziologische Symboltheorie - Psychische Krankheit Als Soziales Problem - „einigkeit Und Recht Und Freiheit - Machining Of Complex Sculptured Surfaces - The World Of Peptides - Neue Generation Neues Erzhlen - Immunopharmacology - Strukturpolitik Zwischen Tradition Und Innovation Nrw Im Wandel - Principles Of Quantum Mechanics - Internetnutzung Von Jugendlichen Einen Auslandsjugendaustausch - Das Unterbewusstsein - Ein Gang Durch Biochemische Forschungsarbeiten - Die Telegraphentechnik - Human Melanoma - Mikroroboter Und Mikromontage - Bevlkerungsentwicklung Rentenfinanzierung Und Einkommensverteilung - Clean Production - Tatort Familie - Die Trken Die Deutschen Und Europa - Journalistenausbildung Eine Vernderte Medienwelt - Industrielle Betriebshrung - Zukunft Der Arbeit Und Geschlecht - Neuroprosthetics From Basic Research To Clinical Applications - Die Verletzungen Der Sehbahnen Des Gehirns Mit Besonderer Bercksichtigung Der Kriegsverletzungen - Der Fall Der Mauer - Whrungsrisiken Im Portfolio - Progress In Industrial Mathematics At Ecmi 94 - Vorschriftsgemyes Entwerfen Nach Bauordnungen Normen Richtlinien Und Regeln - Wege Zu Effektiven Psychotherapien - Abwanderung Und Migration In Mecklenburg Und Vorpommern - Radiology Of Thalassemia - Environmental And Space Electromagnetics - Hygiene Und Ditetik Der Frau - Versorgung Und Frderung Lterer Menschen Mit Geistiger Behinderung - Das Gedingewesen Im Bergbau - Stability Theory - Bildungs- Und Erziehungskatastrophe - Leistung Aus Kultur - Einhrung In Die Allgemeine Konstitutions- Und Vererbungspathologie - Informelles Lernen Im Sport - Telekommunikationsanwendungen Kleine Und Mittlere Unternehmen - Milk Proteins - Irrtum Und Wahrheit Ber Wasserkraft Und Kohle - Telefonstichproben In Deutschland - Einheit Der Wissenschaft - 100 Minuten Konstruktive Teamarbeit - Krebsforschung In Deutschland - Die Lage Des Chequewesens In Deutschland - Die Liberale Nation - Blockierte Demokratien In Der Dritten Welt - Die Gesellschaftliche Verankerung Politischer Parteien - Die Familienpolitik Muss Neue Wege Gehen! - Epidemiological Practices In Research On Small Effects - Coronary Circulation In Physiological And Pathophysiological States - E-branding-strategien - Poetik Des Abgrunds Und Kunst Des Widerstands - Der "ossi" - Die Neue Rechte Eine Gefahr Die Demokratie - Acidification In Finland - Introduction To Formal Grammars - Handbuch Marketing-kommunikation - Aktiv Ins Sekretariat 2000 - Die Groyen Revolutionen Und Die Kulturen Der Moderne - „globalisierung - Die Regierungssysteme Der Deutschen Lnder - Anonymitt Im Internet - Dagstuhl-seminar 1997 - Politikverflechtung Im Vereinigten Deutschland - Corporate Divestiture Management - Strategie Und Technik Des Automobilmarketing - Interstitial Hyperthermia - Handbuch Der Kombinationsbewegungen - Messungen In Fluvialen Systemen - Man Sollte Nicht Den Finger Der Auf Den Mond Weist Den Mond Selbst Halten - Bilanzierung Nach Hgb Us-gaap Und Ias Im Vergleich - Toleranz Weisheit Liebe Oder Kompromiss - Fem-praxis Mit Solidworks - Das Abc Des Verkaufserfolgs - Cerebral Ischemia And Dementia - Merkmale Und Reprsentationen - Tatort Sozialstaat - Parteijugend In Deutschland - Die Grenzgnger - Das Vegetative Nervensystem - Der Trass Seine Entstehung Gewinnung Und Bedeutung Im Dienste Der Technik - Bausteine Syntaktischen Wissens - Reibung Und Schmierung Fester Krper - Europa Zwischen Ordnungswettbewerb Und Harmonisierung - Erfolg Ist Eine Reise - Windkraftanlagen - Die Zukunft Von Nationalstaaten In Der Europischen Integration - Franzsische Apotheken-praxis - Wissenskapitalisten Oder Sldner - Theory And Strategy In Histochemistry - Englische Weltpolitik In Englischer Beleuchtung - Practical Sharepoint 2010 Information Architecture - Fluglehre - Europas Tchter - Die Bewegungsgruppe Einer Euklidischen Ebene - Politik Als Kampagne - Der Eigenbedarf Mittlerer Und Groyer Kraftwerke - Lnderbericht Frankreich - Schein Common Sense Emergency Abdominal Surgery - Schulleitung Forschung Und Qualifizierung - Konvergenz Des Rechnungswesens - Electronic Fashion - Trusts In Deutschland - Beweissicherung Im Bauwesen - Elementare Stochastik - Regieren In Koalitionen - Innere Sekretion - A Course In Mathematical Physics - Plastomechanik Der Umformung Metallischer Werkstoffe - Lsungsbuch Zur Einhrung In Die Festigkeitslehre - Elektrische Kraftbertragung Und Kraftverteilung - Die Stadt Der Zukunft - Didaktik Beruflichen Lehrens Und Lernens - Profitabel Wachsen - Objekte Integrieren Mit Ole2 - Das Knalltrauma - Interaction Evolution And Chaos In Space - Die Reorganisation Der Fabrik Und Die Wiederentdeckung Der Arbeit - Direktmarketing Aus Erster Hand - Nfstellige Tabellen Zu Den Elliptischen Funktionen Five Place Tables Of Elliptical Functions - Wie Das Internet Die Politik Verndert - Geochemistry Of Marine Humic Compounds - Freie Mitarbeit In Den Medien - Advanced Technology In Neurosurgery - Instinkt Und Erfahrung - Afrika Jahrbuch 2000 - Institutionenkonomische Fundierung Effizienter Geldpolitik - Vito Volterra - Konzertierung Verhandlungsdemokratie Und Reformpolitik Im Wohlfahrtsstaat - Der Staat Der Autonomen Gemeinschaften In Spanien - Erwerbsbiographien Und Materielle Lebenssituation Im Alter - Eeg Atlas For Anesthesiologists - –konomie Der Werbung - Das Kieselsuregel Und Die Bleicherden - Sprache Des Deutschen Parlamentarismus - Astronomische Miniaturen - Jahrbuch Verkaufstraining 9899 - Handbuch Bankcontrolling - Nationale Mindestsicherungssysteme Und Europische Integration - Die Blei-zinkerzlagersttte Von Bleiberg-kreuth In Krnten - Investment - Die Bedeutung Von Morphemen Die Sprachanalyse - Qualitten Polizeilichen Handelns - Pressefreiheit Unter Druck - Jugendtypen - Pro Sql Server 2012 Administration - Professionalitt - Elemente Der Funktionalanalysis - Das Abzahlungsgeschft In Handel Und Industrie Und Seine Finanzierung - Magnetogasdynamics And Plasma Dynamics - Physics Of Gravitating Systems I - Wirtschafts- Und Bevlkerungsstatistik - Ngos Als Legitimationsressource - Mechanical Behavior Of Materials Under Dynamic Loads - Vergaberecht In Der Unternehmenspraxis - Coaching Als Maynahme Der Personalentwicklung - Technischer Lehrgang Starterbatterien - Technische Mechanik - Engineering Mechanics - Die Ambulante Automatische 24-h-blutdruckmessung - Bettine Von Arnims Briefromane - Ddr Und Osteuropa - Neuorientierung Im Wirtschaftjournalismus - Handbuch Jugend Und Musik - Deutschland Denken - Akkreditierung Als Mikropolitik - Wertkarten Zahlungsverkehr - Lassalles Briefwechsel Von Der Revolution 1848 Bis Zum Beginn Seiner Arbeiteragitation - Vom Chaos Zum Konsens - Body Experience - Robuste Brcken - Early Organic Evolution - Parallele Numerik - Die Europisierung Nationaler Beschftigungspolitik - Chronik Der Kinderradiologie - Erziehen Als Profession - Generation Und Gedchtnis - Allgemeine Sinnesphysiologie - Der Quecksilberdampf-gleichrichter - 3 Kongrey Der Deutschen Gesellschaft Intraokularlinsen Implantation - Handbuch Werbeforschung - Das Harz Der Nadelhlzer Seine Entstehung Vertheilung Bedeutung Und Gewinnung Forstmnner Botaniker Und Techniker - Pflegesicherung In Europa - Die Entstehung Der Gesteine - Jugend 19001970 - –kologisches Arbeiten - Die Kunst Des Clusterns - Heidelberger Gelehrtenlexikon - Auyenpolitik Und Auyenwirtschaft Der Volksrepublik China - Maternal Obesity And Pregnancy - The Changing Faces Of Ireland - Deutsch „rztinnen Und „rzte - Einhrung In Die Soziologie Der Behinderung - Cea Computergesttzte Erfahrungsgeleitete Arbeit - Leukemias - Die Chemie Des Lignins - Lees Ophthalmic Histopathology - Medienrezeption Als Aneignung - Trauma Aids - Kommunikationsmanagement - Qualifizierte Facharbeit Im Spannungsfeld Von Flexibilitt Und Stabilitt - Politische Bildung Und Globalisierung - Soziologie Des Fremden - Autonome Neuropathie Bei Diabetes Mellitus - Das Politische System Der Niederlande - Lnger Erwerbsttig Aber Wie - Die Wlzlager - Meyverfahren Der Experimentellen Mechanik - Funktionsdiagnostik Des Linken Ventrikels Mittels Zweidimensionaler Echokardiographie - Abriss Der Dauermagnetkunde - Handbuch Der Chemischen Untersuchung Der Textilfaserstoffe - Events - Erlebnismarketing Alle Sinne - Norm Herrschaft Und Vertrauen - Planung Die Deutsche Einheit - Krisenmanagement Bei Strfllen - Bevlkerungslehre Und Bevlkerungspolitik Im „dritten Reich - Multiprozessorsysteme - Innen Beginnen - Zwerchfellpathologie Im Rntgenbild - Risk Analysis And Decision Processes - Die Entstehung Der Arten Und Hheren Kategorien - Systemdynamik Und Simulation - Psychoanalyse Heute - Kernphysik - Allgemeines Und Gaskatalyse - Einhrung In Die Analysis - Steuerung Und Planung Im Wandel - Parteienfinanzierung - Interface Oral Health Science 2011 - Pflanzenernhrung Wurzelleistung Und Exsudation - Mineralle Und Verwandte Produkte - Soziale Konstruktion Von Geschlecht Im Sport - Interstellar Magnetic Fields - Handbook Of Pediatric Cardiovascular Drugs - Die Edelstahlerzeugung - Familientherapie Und Familienforschung - Wireless-netzwerke Den Nahbereich - Haushalte Ohne Auto - Digitale Demokratie - Wie Vorhersagbar Sind Grundschulnoten - Das Atom Und Die Bohrsche Theorie Seines Baues - Kurzes Lehrbuch Der Anorganischen Chemie - Animal Acoustic Communication - Mathematischer Einhrungskurs Die Physik - Vom Wert Der Wohlfahrt - Elemente Der Regelungstechnik - Cable Shielding For Electromagnetic Compatibility - Verkauf Von Versicherungen Und Finanzdienstleistungen Ist Keine Magie - Feministische Staatstheorie - Methoden Der Digitalen Bildsignalverarbeitung - Mythos Determinismus - Strahlungsquellen Technik Und Medizin - Funktionelle Elektrostimulation - Turbulent Shear Flows 6 - Geology Of Holocene Barrier Island Systems - Repetitorium Mathematik - Klinische Rntgendiagnostik Der Erkrankungen Der Brustorgane - Aus Der Weiyen Stadt - Kompendium Event-organisation - Prnatale Dopplerdiagnostik - Virtuelle Wirtschaft - Geometry Of Quantum Theory - Mehrfachausbildungen In Deutschland - Verbrennungsmotoren - Ganzheitliche Bilanzierung - Elektromagnetische Vertrglichkeit - Das Fremde - Atlas Des Mittel- Und Zwischenhirns Des Kaninches - Romantik Und Gewalt - Einhrung In Die Physikalische Chemie Der Eisenhttenprozesse - Technologiemanagement And Marketing - Arbeiten Der Lehrkanzel Tierzucht An Der Hochschule Bodenkultur In Wien - Die Mercerisation Der Baumwolle Und Die Appretur Der Mercerisierten Gewebe - Wahlkampf In Baden-wrttemberg - Modeling Simulation And Optimization Of Complex Processes - Sprachwandel Durch Computer - Bildungsentscheidungen Als Sozialer Prozess - Handelsmarketing - Frauen In Den Naturwissenschaften - Die Anfangsstadien Der Wichtigsten Geisteskrankheiten - Soziale Arbeit Und Demokratie - Value Theory - Versuchungen - Sandostatin In The Treatment Of Acromegaly - Applied Stochastic System Modeling - Pathologie Und Bakteriologie Der Endokarditis - Personalpolitische Handlungsalternativen Mit Lteren Arbeitnehmern In Unternehmen Vor Dem Hintergrund Der Demographischen Entwicklung In Deutschland - Umweltpolitik - Higher Education And Human Capital Rethinking The Doctorate In America - Grundkurs Wirtschaftsinformatik - Aufgaben Aus Der Hydromechanik - Grundlagen Der Statistik Und Ihre Anwendungen - Interdisziplinre Managementforschung Und -lehre - Social Costs Of Energy - Gruppentherapie Mit Kindern - Spezielle Mineralogie Auf Geochemischer Grundlage - Prototyping Komplexer Softwaresysteme - Das Elend Der Suchtprvention - Marktwirtschaft - Die Politische Soziologie C Wright Mills - Von Handy Glasfaser Und Internet - Der Betriebs-chemiker - Allgemeine Und Physiologische Chemie Der Fette Chemiker Mediziner Und Industrielle - Kinder Und Der Medienmarkt Der 90er Jahre - Marketing Den Mittelstand - Jahresbericht Ber Die Beobachtungs-ergebnisse Der Von Den Forstlichen Versuchsanstalten - Soziale Kontrolle Und Individualisierung - The Protistan Cell Surface - Elektronenmikroskopische Hmatologie - Regionalisierung Sozialwissenschaftlicher Umfragedaten - Spielen In Virtuellen Welten - Betriebliches Energiemanagement - Hrungsfrderndes Human Ressource Management - Gespaltene Jugend - Kraft- Und Wrmewirtschaft In Der Industrie - Broken Markets - „ertragt Mich Dass Ich Rede - Migration Familie Und Gesellschaft - Als Kontrolliert Wurde Was Mit Dem Taler Geschah - Total Knee Replacement - Der Psychopath - Prfungstrainer Physik - Fuyball Verbindet - Durch Ausgrenzung - Die Gegenwrtigen Strmungen In Der Psychiatrie - Das Machiavelli-syndrom - Peter Weiss Jahrbuch 6 - Die Entgrenzung Der Mnnlichkeit - Internationaler Vertrieb - Die Physikalischen Und Chemischen Methoden Der Quantitativen Bestimmung Organischer Verbindungen - Staatsbrgerschaft Im Einwanderungsland Deutschland - Prospects And Risks Beyond Eu Enlargement - Management In Der Hypermoderne - Entwicklung Der Offenen Jugendarbeit In Wolfsburg - Das Armenisch-aserbaidschanische Verhltnis Und Der Konflikt Um Berg-karabach - Entwicklung Und Gegenwrtiger Stand Der Kokereiindustrie Niederschlesiens - Was Jetzt - Briefe Von Und An Lassalle Bis 1848 - Bewusstseinsvorgang Und Gehirnprozess - Sozialpolitik Und Soziale Lage In Deutschland - 1+1=10 Mathematik Hhlenmenschen - X-ray Diffraction By Disordered Lamellar Structures - Neuordnung Der Lehrerausbildung - Parlamente Und Systemtransformation Im Postsozialistischen Europa - Strmungsmaschinen - Theoretische Meteorologie - Deutsch-franzsische Geschftsbeziehungen Erfolgreich Managen - Berufswahl Und Bewhrung - Die Usa Am Beginn Der Neunziger Jahre - Fortschritte Der Theerfarbenfabrikation Und Verwandter Industriezweige - Generator-kraftgas- Und Dampfkessel-betrieb In Bezug Auf Wrmeerzeugung Und Wrmeverwendung - Ethical Social Index Numbers - Beobachtung In Der Schule Beobachten Lernen - Wirtschaftsberichterstattung In Der Boulevardpresse - Psychiatry And Philosophy -